(data stored in ACNUC7421 zone)

EMBL: AP009493.PE549

AP009493.PE549       Location/Qualifiers
FT   CDS_pept        631871..632119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_549"
FT                   /product="putative 30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_549"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17378"
FT                   /db_xref="GOA:B1VRG0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VRG0"
FT                   /protein_id="BAG17378.1"
FT                   /translation="MARQQEPRKPFKSRPNPLDAAEITYIDYKDTDLLRRFVSDRGKIR
FT                   GRRVTRISARQQRQVAAAIKNAREMALLPYTGSPAGT"
     atggcccgtc agcaggaacc ccgcaaaccg ttcaagagcc ggccgaaccc cctggacgcc        60
     gcggagatca cgtacatcga ctacaaggac accgatctgc tgcggaggtt cgtctccgac       120
     cgagggaaga tccgaggccg ccgggtcacc cggatcagcg cccggcagca gcggcaggtg       180
     gccgcggcga tcaagaacgc ccgcgagatg gccctgctgc cgtacaccgg gtccccggcg       240
     ggcacctag                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page