(data stored in ACNUC7421 zone)

EMBL: AP009493.PE552

AP009493.PE552       Location/Qualifiers
FT   CDS_pept        635109..635909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_552"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_552"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17381"
FT                   /db_xref="GOA:B1VRG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG3"
FT                   /protein_id="BAG17381.1"
FT                   /translation="MTIAYDRTDVVHGADLRLPRGRVTALIGPNGSGKSTLLRAVARLH
FT                   KARTGRVTVAPQGEGSEPVDALALSRSDFARRVTLLAQSRNAPAGLSVRDVVGFGRHPY
FT                   RARLRGTDPDGARMVEHALTVTNLTEFADRGVESLSGGQLQRVWFACCLAQDTDVLLLD
FT                   EPTTYLDLRYQVEILDLVRDLADTHGVTVGVVLHDLDQAAAVADQVVLLSSGRIVAAGT
FT                   PAEVYAPERLSDAYGIRIDVEPDSSTGIPRTRAVGRHHLRSERP"
     atgacgatcg cgtacgaccg taccgacgtc gtgcacgggg ccgacctccg gctgccgcgc        60
     ggacgcgtca ccgcgctcat cgggccgaac ggcagtggca agtccaccct gctgcgggcc       120
     gtggcccggc tgcacaaggc ccgcaccggc cgggtgaccg tggcgcccca gggcgagggc       180
     tccgagcccg tcgacgccct cgccctgtcc cgttccgact tcgcccgccg ggtcaccctg       240
     ctcgcgcaga gccgcaacgc accggccggc ctcagcgtgc gcgacgtggt cggattcggc       300
     cgccacccct accgggcccg gctccgggga accgatccgg acggggcccg gatggtcgag       360
     cacgcgctga ccgtcacgaa cctcaccgag ttcgccgacc gcggggtgga gagcctgtcc       420
     ggcgggcagt tgcagcgcgt ctggttcgcc tgctgcctgg cccaggacac cgacgtactc       480
     ctcctcgacg agccgaccac ctatctcgac ctgcgctacc aggtcgagat cctcgacctc       540
     gtccgcgacc tcgccgacac gcacggcgtc accgtcggcg tcgtcctgca cgacctggac       600
     caggccgccg ccgtggcgga ccaggtcgtc ctcctctcct ccgggcggat cgtcgccgcg       660
     gggacccccg cggaggtcta cgcccccgag cggctcagcg acgcgtacgg catccgcatc       720
     gacgtcgaac ccgactcctc caccggcatc ccgcgcaccc gcgcggtcgg ccgccaccac       780
     cttcgttccg aaaggccctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page