(data stored in ACNUC7421 zone)

EMBL: AP009493.PE553

AP009493.PE553       Location/Qualifiers
FT   CDS_pept        635918..636892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_553"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_553"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17382"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG4"
FT                   /protein_id="BAG17382.1"
FT                   /translation="MKNQHLTWPVLAAAAALALTACGTTEAPKKESAKDSAVTITDARG
FT                   KKITLDGPAERVVGTEWNVVESLVTLGVQPVGVADVKGYTAYNTAAPLAKGIKDIGTRG
FT                   EPSVATVASLKPDLILATTDLSDSAIAQLSKAAPVAVVRSADASRQIDQMVDTVELIGK
FT                   ATGNEDKAESEVDSFRKAVADGKKKLADAGLDGEKVAFADGWQEGNQVSVRPYVKGSLL
FT                   SDVNTELGLVDPWKLKGDAAYGLAATDVEGLTKIGDARFAYIANDSDGGDPFADGLKDN
FT                   AVWKSLPFVKNDEVHRLPDGIWMFGGTASMREYIDALVGALTA"
     atgaagaacc agcacctgac gtggcccgtc ctcgccgccg cggccgcgct cgccctcacg        60
     gcctgcggca ccaccgaggc gccgaagaag gagtccgcca aggacagcgc ggtgacgatc       120
     accgacgccc gcgggaagaa gatcacgctc gacggtccgg ccgaacgcgt cgtcggcacc       180
     gagtggaacg tcgtcgagtc gctcgtgacc ctcggcgtcc agccggtcgg cgtggccgac       240
     gtcaagggct acaccgcgta caacacggcc gcgccgctgg ccaagggcat caaggacata       300
     ggcacccgcg gcgagcccag cgtcgccacc gtcgcgagcc tcaagcccga cctcatcctc       360
     gccaccaccg acctgtccga ctccgccatc gcgcagctgt ccaaggccgc cccggtcgcc       420
     gtggtgcgct cggccgacgc gagccggcag atcgaccaga tggtcgacac cgtcgaactc       480
     atcggcaagg ccaccggcaa cgaggacaag gccgagtccg aggtcgactc cttccgcaag       540
     gccgtcgcgg acggcaagaa gaagctcgcg gacgccggtc tcgacggcga gaaggtcgcc       600
     ttcgccgacg gctggcagga gggcaaccag gtctcggtcc gcccgtacgt caagggctcg       660
     ctgctctccg acgtcaacac cgaactcggc ctcgtcgacc cgtggaagct gaagggcgac       720
     gcggcctacg gcctggcggc gaccgacgtc gagggcctca cgaagatcgg cgacgcgcgg       780
     ttcgcgtaca tcgccaacga ctccgacggc ggcgacccgt tcgccgacgg gctcaaggac       840
     aacgcggtgt ggaagtccct cccgttcgtc aagaacgacg aggtccaccg gctgcccgac       900
     ggcatctgga tgttcggcgg caccgcgtcg atgcgtgagt acatcgacgc cctcgtcggc       960
     gcgctgaccg cctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page