(data stored in ACNUC7421 zone)

EMBL: AP009493.PE557

AP009493.PE557       Location/Qualifiers
FT   CDS_pept        complement(641140..641589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_557"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17386"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG8"
FT                   /protein_id="BAG17386.1"
FT                   /translation="MEDSGAGSVPPPNGADVQDPAAQARLVALVAEWSAAIVSNDVSRI
FT                   RAFMAEEWVIVSESGITDRDAFLGFVASGDLTHSAMRSISPPRVRVHRDTATVTARMTN
FT                   TAHYAGRRFDADEWVTDVFVRREGLWLCVLTHITSAAPTDPAPAV"
     atggaagaca gcggagccgg ctccgtgccg ccgccgaacg gcgccgacgt ccaggacccc        60
     gcggcacagg cccggctcgt cgccctggtg gcggagtggt ccgccgcgat cgtctcgaac       120
     gacgtgtcga ggatcagggc gttcatggcg gaggagtggg tcatcgtctc cgagtccggc       180
     atcacggacc gggacgcgtt cctcggcttc gtcgcgtccg gcgacctgac ccactcggcg       240
     atgcggtcca tcagcccgcc gagggtccgc gtccaccggg acaccgccac cgtcaccgcg       300
     cggatgacga acacggccca ctacgccggc cgccgcttcg acgccgacga atgggtcacc       360
     gacgtcttcg tccgacgcga gggcctgtgg ctgtgcgtgc tcacccacat cacctccgcc       420
     gccccgacgg accccgcgcc cgccgtatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page