(data stored in ACNUC7421 zone)

EMBL: AP009493.PE558

AP009493.PE558       Location/Qualifiers
FT   CDS_pept        complement(641702..642256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_558"
FT                   /product="conserved hypothetical protein containing a
FT                   MaoC-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_558"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17387"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG9"
FT                   /protein_id="BAG17387.1"
FT                   /translation="MTLRHVKDNEYVEEHGGDYEDFEPGMVIRHWPGRTLSEADNTWLT
FT                   LLTMNQHPLHFDQHYGAGAEYGKVLVNSGITLCLVGGMTVQALSARAVANLGWDRVRLK
FT                   TPVFVGDTLYATSRILDKRLSRSRPGQGIITVETTGTKSTGETVIVFERSFMVRCRELP
FT                   APPTERTRKEATTAVEGAPPA"
     atgaccctgc gccacgtcaa ggacaacgag tacgtcgagg aacacggcgg cgactacgag        60
     gacttcgaac cgggcatggt gatccggcac tggccgggcc gtaccctctc cgaggccgac       120
     aacacctggc tgaccctgct gacgatgaac cagcacccgc tccacttcga ccagcactac       180
     ggcgccggag ccgagtacgg aaaggtcctg gtgaacagcg gcatcacgct gtgcctggtc       240
     ggcgggatga ccgtgcaggc gctgtcggcg cgggcggtgg ccaacctcgg ctgggacagg       300
     gtccggctga agactcccgt cttcgtcggc gacaccctgt acgcgacgag ccgcatcctc       360
     gacaaacggc tgtcccggtc ccggccgggg cagggcatca tcacggtgga gacgaccggc       420
     acgaagtcga cgggagagac cgtcatcgtc ttcgaacggt ccttcatggt ccgctgccgt       480
     gagctccccg ccccgccgac ggaacggacc cgcaaggagg cgaccaccgc tgtcgagggc       540
     gccccgccgg cgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page