(data stored in ACNUC7421 zone)

EMBL: AP009493.PE559

AP009493.PE559       Location/Qualifiers
FT   CDS_pept        complement(642342..643700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_559"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17388"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH0"
FT                   /protein_id="BAG17388.1"
FT                   /translation="MDTHEELAPGQGHPWFGRHRLRPAAPAETIRRMLRHELRDTGWPY
FT                   QKILPAAPIAIPRASYAEIFRVSLALVDLLRRAALESGHTTADRLTAYEMPATEDRLWL
FT                   RDPFVEERYADSVVRPDLVIGPDGPQFLEFNVSGALGGVVETQSRLSVWRGLHADEEGR
FT                   TPFRSPSPFAVRAEMFRALSAESAVAPRVAVVGSARVTGVERRYFEMEADHYNSHGLTA
FT                   RFFEPEELHEAWDCAPHLRYPVGLRNFTIPDWLDAGLDTTPVQDALDHGCLLVGTQTST
FT                   FLHSKLTMGLLSEGRPWMTEADRGLVARYLPWTRILSERRTDRGGQPVDLVPFVLKNRE
FT                   RLVLKAALGESGRQVLIGRRTEQAAWESAVGEAARGRTSVVQEFVEPATCRVSLIADGI
FT                   DEPYDADVAPVLGPLLFGGRPAGLFCRFFGDGSAGIVSVRGGTSSSDNVMVAI"
     atggacacgc atgaggaact cgctcccggg caggggcacc cgtggttcgg ccggcaccgg        60
     ctgaggcccg ccgccccggc ggagacgatc cgccggatgc tgcggcacga actgcgggac       120
     accggctggc cgtaccagaa gatccttccc gccgcgccga tcgcgatccc gcgcgcctcc       180
     tacgccgaga tcttccgggt gagcctcgcc ctggtcgacc tgctgcgccg ggccgccctg       240
     gagagcgggc acaccaccgc cgaccggctg acggcctacg agatgcccgc caccgaggac       300
     cggctctggc tgcgcgaccc cttcgtcgag gagcggtacg ccgactccgt ggtgaggccg       360
     gatctggtca tcgggcccga cgggccgcag ttcctggagt tcaacgtcag cggcgcgctc       420
     gggggagtgg tggagaccca gagccgtctg tcggtgtggc gcgggctgca cgccgatgag       480
     gagggccgga ccccgttccg gtcgccgagc ccgttcgccg tacgggccga gatgttccgg       540
     gcgctcagcg ccgagtcggc ggtggcgccg agggtggccg tcgtcggcag cgcccgggtg       600
     acgggcgtgg agcggcggta cttcgagatg gaggccgacc actacaacag ccacggcctg       660
     accgcacgct tcttcgagcc ggaggaactc cacgaggcct gggactgcgc cccgcatctg       720
     cgctatcccg tcggcctgcg gaacttcacc atcccggact ggctcgacgc cggcctcgac       780
     accaccccgg tccaggacgc cctggaccac ggctgcctgc tggtgggcac ccagacgtcg       840
     acgttcctgc acagcaagct caccatgggg ctgctgtccg agggacggcc ctggatgacc       900
     gaggccgacc gcgggctcgt cgcccggtat ctgccgtgga cacggatcct ctccgagcgc       960
     aggaccgacc gcgggggaca gcccgtcgac ctggtgccgt tcgtgctgaa gaaccgtgag      1020
     cggctggtgc tcaaggccgc cctcggggag agcggacgac aggtgctcat cggccgccga      1080
     accgagcagg ccgcgtggga gtcggccgtc ggcgaggccg cccggggccg caccagcgtg      1140
     gtccaggagt tcgtggagcc ggccacctgc cgggtgtcgc tgatcgccga cgggatcgac      1200
     gagccgtacg acgccgatgt cgcaccggtg ctgggccccc tgctgttcgg cggccggccg      1260
     gccggcctgt tctgccggtt cttcggcgac ggttccgccg ggatcgtcag cgtccggggc      1320
     ggaacgagca gttccgacaa cgtgatggtg gcgatctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page