(data stored in ACNUC7421 zone)

EMBL: AP009493.PE562

AP009493.PE562       Location/Qualifiers
FT   CDS_pept        complement(645575..646828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_562"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17391"
FT                   /db_xref="GOA:B1VRH3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH3"
FT                   /protein_id="BAG17391.1"
FT                   /translation="MSERRTITPTHRYRNNDKLIGIGNAFWNRSYENGVAGIVGDLEDG
FT                   VFHMPDGHEFVNFTVCSYLDLDTHPAVIDGAVASLRRFGVLDHCIPRTRVQTPVLLELE
FT                   ESLGELFGAMVISALSTAAASTGLLPMIASGHLGNGTRPLMVFDKNAHVSLAHAKPSCA
FT                   DESEVVTCGHHDLDFIEDMCLTYERVCYVVDGSDSLGGYAPVQELAELQDKYNLLVFYD
FT                   DSHSLSAYGERGIGYVRTHSPVLDERTITVATLTKGFGAGGTAILLDGYPEQTRRLVER
FT                   FAGPLGYSQKMNAAAVGAALASAEIHRTEELTRLQGRLRSNIALFDSLVQTEQAEGTYP
FT                   IRVVPMSDDTVVDAAKQVFAAGFYTSPVFFPIVARGTAGLRVMLRAGQSADQIKRLCTA
FT                   LVEAGARPAGPLPGAVHR"
     atgagcgagc gcaggaccat cacccccacc caccggtacc gcaacaacga caaactcatc        60
     gggatcggca acgccttctg gaaccgttcc tacgagaacg gggtcgccgg catcgtcggc       120
     gacctggagg acggcgtctt ccacatgccc gacgggcacg agttcgtcaa cttcaccgtc       180
     tgctcctacc tggacctgga cacccacccc gcggtcatcg acggggcggt cgcctcactg       240
     cgccgcttcg gggtgctcga ccactgcatc ccgcgcaccc gcgtccagac ccccgtgctg       300
     ctggaactgg aggagtccct gggcgagctg ttcggcgcga tggtgatcag cgcgctctcc       360
     accgccgcgg ccagcaccgg gctgcttccc atgatcgcgt cgggacacct gggcaacggc       420
     accaggcccc tgatggtctt cgacaagaac gcccacgtct ccctggcgca cgccaagccg       480
     agctgcgccg acgagagcga ggtcgtgacc tgcggccacc acgacctcga cttcatcgag       540
     gacatgtgcc tcacctacga acgcgtctgc tacgtggtgg acggctcgga cagcctcggc       600
     ggctacgccc ccgtccagga actggccgaa cttcaggaca agtacaacct cctggtcttc       660
     tacgacgact cgcactcgct gtccgcgtac ggcgagcgcg gcatcggcta cgtacgcacc       720
     cactccccgg tgctcgacga gcggaccatc accgtggcga ccctgaccaa ggggttcgga       780
     gccggaggca ccgcgatcct gctcgacggc taccccgaac agacgcgccg gctcgtcgaa       840
     cggttcgcgg gccccctggg ctactcgcag aagatgaacg ccgccgccgt cggcgcggca       900
     ctcgcctcgg ccgagatcca ccgcaccgag gaactcacgc ggctgcaggg gcgcctgcgc       960
     tccaacatcg cgctgttcga ctccctcgtc cagaccgaac aggccgaggg cacctacccg      1020
     atccgggtgg tgccgatgag cgacgacacg gtcgtcgacg ccgcgaaaca ggtcttcgcg      1080
     gcggggttct acacctcacc ggtgttcttc cccatcgtcg cgcgcggcac cgccggactg      1140
     cgggtcatgc tgcgggccgg ccagagcgcg gaccagatca agcggctctg caccgcgctg      1200
     gtcgaggccg gggcacgccc ggcgggcccg ctccccgggg cggtgcaccg gtga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page