(data stored in ACNUC7421 zone)

EMBL: AP009493.PE563

AP009493.PE563       Location/Qualifiers
FT   CDS_pept        complement(646825..647727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_563"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17392"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH4"
FT                   /protein_id="BAG17392.1"
FT                   /translation="MRPGDERRTSDMAVPEAVPGPNGTAGVEITRMTFDEFLAVGPRGL
FT                   YKADRPVVIKLPADVQGLGRDEVAERLAGMTVTLFTEPGDKNHPGRWETRDIKLREFFA
FT                   DERHLTATDTWHRVVSNIRSSPADVNAVIGFDAEEFFGYGDSLYAANLWISHRGVFTKN
FT                   HFDEFENFNIALEGRKRFIIAPPGVRAYYPRSVLRGFGDKSNVVDLDDADLSRYPRLAA
FT                   KLAQRRDFVLEPGHMLYLPLGWWHQAESLDELNINVNFWLKSKKILHRPHVLGVALYTY
FT                   AYRRLKGVYSYKPTEGNSR"
     atgagacccg gcgacgagag gaggaccagc gacatggcag ttccggaagc tgtgcccggg        60
     ccgaacggga cagcgggtgt cgagatcacc cgtatgacgt tcgacgagtt cctggccgtg       120
     ggcccccggg ggctgtacaa ggccgaccgc cccgtggtga tcaagctgcc ggccgacgtg       180
     caggggctcg gacgggacga agtggccgag cgcctggccg ggatgaccgt caccctgttc       240
     accgagccgg gcgacaagaa ccacccgggg cgctgggaga cccgggacat caagctccgc       300
     gagttcttcg cggacgagcg gcacctgacc gccacggaca cctggcaccg cgtggtgtcg       360
     aacatccgca gcagcccggc cgacgtgaac gccgtcatcg gcttcgacgc cgaggagttc       420
     ttcggctacg gcgacagcct gtacgcggcc aacctgtgga tcagccaccg cggcgtgttc       480
     accaagaacc acttcgacga gttcgagaac ttcaacatcg cgctcgaagg ccgcaagcgc       540
     ttcatcatcg ccccaccggg cgtgcgcgcc tactacccga ggtcggtgct gcgcgggttc       600
     ggggacaagt ccaacgtggt cgacctcgac gacgccgacc tgtcgcgcta cccgaggctc       660
     gccgccaagc tcgcccaacg ccgcgacttc gtcctcgaac cggggcacat gctctacctg       720
     ccgctcggct ggtggcacca ggccgaatcg ctggacgagc tgaacatcaa cgtcaacttc       780
     tggctcaagt ccaagaagat cctccaccgg ccgcacgtac tcggcgtcgc cctgtacacg       840
     tacgcctacc ggagactcaa gggcgtctac agctacaagc ccaccgaggg gaactcccga       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page