(data stored in ACNUC7421 zone)

EMBL: AP009493.PE567

AP009493.PE567       Location/Qualifiers
FT   CDS_pept        651869..653260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_567"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17396"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH8"
FT                   /protein_id="BAG17396.1"
FT                   /translation="MTTTTSPHTPPRSRLGHAYGEQLARNGSAGRPTAAALESATLRLA
FT                   YQDRFLNGPAFLGGSELRTLVGDLHTVYGLLRSLPERGFGGSVTALAAAVGLEPSQAAL
FT                   ITRSARTGSLLPLGRADLYHDGSGFKLLEFNITSALGGFENADINRAMLAYPPLDAFVT
FT                   RHRLRYEDTLGHMVRTMYAECAANIPAGRAPVVAVVDTVENFAVVGPRLRVFAEKLADF
FT                   GVEGIACDLGEITYPNGRPTVAGRTVDVVFRYFLPEDLTDPVAAAQLEPLLTAVERGGL
FT                   GLFSRLDAELYGNKGTLAMLSDEEHRDRYDAAELACLDRILPWTRYVRPRATDPGGSRV
FT                   DLLSHARGHQHELILKPTLLHGGNGIIAGWTVDPAEWESRVASAMDGPFVLQRRVRPTA
FT                   EPFPDGAGGVRELFLNWGLYLGARGTEEDGYAGGFVRGSADPAVGVVSMGSGATVGCVF
FT                   HGGDS"
     atgacgacga ccacgagtcc gcacacgccg cccaggtcgc ggttgggcca cgcgtacggg        60
     gagcagctcg cgcggaacgg gtcggcgggc cgtcccacgg ccgcggcact ggagtccgcc       120
     acgctgcgac tggcctacca ggaccggttc ctcaacggcc ccgccttcct cggcgggagc       180
     gagctccgca ccctcgtggg agacctccac accgtctacg ggctgctgcg ctcgctgccg       240
     gagcgcgggt tcggcggaag cgtcaccgca ctggccgcgg ccgtcggcct ggaaccctcg       300
     caggcggcgc tgatcaccag gagcgcccgg accgggtcgc tcctcccgct ggggcgggcg       360
     gatctctacc acgacggctc ggggttcaag ctgctggagt tcaacatcac cagcgcgctc       420
     ggcggtttcg agaacgcgga catcaaccgg gcgatgctgg cctatccccc gctcgacgcg       480
     ttcgtgacgc ggcaccgact gcgctacgag gacacgctgg gccacatggt gcggacgatg       540
     tacgcggagt gcgccgcgaa catcccggcc gggcgggcgc ccgtcgtcgc cgtggtggac       600
     acggtggaga acttcgccgt cgtgggaccc cgacttcggg tgttcgccga gaagctggcc       660
     gacttcgggg tcgaggggat cgcatgcgac ctcggcgaga tcacgtaccc gaacggccgt       720
     ccgacggtcg ccggccgaac cgtcgacgtg gtcttccggt atttcctgcc cgaggacctc       780
     accgaccccg tcgcggcggc ccagttggag ccgctgctga ccgcggtcga gcggggcggg       840
     ctgggcctgt tcagccgact ggacgccgaa ctgtacggca acaagggcac cttggcgatg       900
     ctctccgacg aggagcaccg ggaccggtac gacgccgccg aactggcgtg cctcgaccgg       960
     atcctgccgt ggacgcggta cgtgcgcccc cgcgccacgg accccggtgg cagccgggtc      1020
     gacctgctct cccacgcacg cggccaccag cacgaactga tcctgaagcc gacgctgctg      1080
     cacggcggca acgggatcat cgccggctgg acggtggacc cggccgagtg ggagagccgg      1140
     gtcgcctcgg cgatggacgg cccgttcgtc ctccagcgcc gggtacgtcc caccgccgaa      1200
     ccgtttcccg acggggccgg cggcgtgcgg gaactcttcc tcaactgggg cctctacctc      1260
     ggcgcacgcg gcaccgagga ggacggctac gcgggcggct tcgtacgcgg cagcgccgat      1320
     ccggcggtgg gggtcgtcag catgggcagc ggcgccacgg tcggctgcgt cttccacggc      1380
     ggcgacagct ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page