(data stored in ACNUC7421 zone)

EMBL: AP009493.PE568

AP009493.PE568       Location/Qualifiers
FT   CDS_pept        complement(653445..653609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_568"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17397"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH9"
FT                   /protein_id="BAG17397.1"
FT                   /translation="MFGYGPGAFDDAWSGITADELGAGFPGWRLVDVTPGTNPVPTFWF
FT                   TLRRGAAPA"
     atgttcgggt acgggcccgg ggcgttcgac gacgcgtggt ccggcatcac cgcggacgaa        60
     ctcggcgccg ggttccccgg gtggcgactg gtcgacgtga cgcccggcac gaacccggtc       120
     ccgaccttct ggttcacgct gcgccggggt gcggccccgg catga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page