(data stored in ACNUC7421 zone)

EMBL: AP009493.PE569

AP009493.PE569       Location/Qualifiers
FT   CDS_pept        653858..654250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_569"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17398"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI0"
FT                   /protein_id="BAG17398.1"
FT                   /translation="MAVQTVYFVFRNKRALFKDVVDTSIAGDVEPVATMDRDWFRAACA
FT                   EPTAAAQLRAHVSGVRGILVRVAPIMPLIAAAAASDPEIAAQWPSGPDPRYTVQHAAAK
FT                   ALTSKPDAWEAWARATLIDHLCTDHA"
     gtggccgtcc agaccgtgta cttcgtgttc cggaacaagc gcgcgctgtt caaggacgtc        60
     gtcgacacct ccatcgcggg cgatgtcgaa ccggtcgcca cgatggaccg cgactggttc       120
     cgcgccgcgt gcgccgagcc caccgcggcc gcgcaactgc gcgcccacgt gagcggggtg       180
     cgcgggatcc tcgtccgggt cgccccgatc atgccgttga tcgcggcggc ggcggcctcg       240
     gacccggaga tcgcagcgca gtggccctcc ggccccgacc cgcgctacac cgttcagcac       300
     gccgcggcga aggcgctgac ctccaagccc gacgcctggg aggcgtgggc ccgcgcgacc       360
     ctgatcgacc acctctgcac ggaccacgcg tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page