(data stored in ACNUC7421 zone)

EMBL: AP009493.PE572

AP009493.PE572       Location/Qualifiers
FT   CDS_pept        complement(656997..657815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_572"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17401"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI3"
FT                   /protein_id="BAG17401.1"
FT                   /translation="MMHLPQWRVLRDGDADLVLTVAFDPGRGNANFSDLARCLGGRRVL
FT                   EAVPRRTTVAALRDEGVDGYVAPWLEAVKEHGKPVKAVLGHCGGDSLARELAIGVRAWG
FT                   LGEPSLMTFDPLVVDGSVLVEEYRVAVGALVAQLTPRDLEPALAAAESHDPASAAGGSD
FT                   LLSLAETLERAYRTAAAAACRNVSVAPAVQQQLCDRFSAYLTYLAAAARARSAHPSAHA
FT                   PIATTVLSATADAGPRTADPCGTITRFAVGPDRLLGDPEVAAHVSRALSG"
     atgatgcact tgcctcagtg gcgcgtactg cgcgacggcg acgcggacct ggtcctcacg        60
     gtggccttcg acccgggacg cggcaacgcc aacttctcgg acctcgcgcg ctgtctgggc       120
     gggcggcgag tcctggaggc cgtaccgcgg cgcaccaccg tcgccgccct ccgggacgag       180
     ggggtcgacg gctatgtggc gccctggctg gaggccgtca aggagcacgg taaaccggtg       240
     aaggccgtgc tcgggcactg cgggggcgac tccctggccc gggaactggc catcggcgta       300
     cgggcgtggg gactgggcga accctcgctg atgaccttcg acccgctggt ggtcgacggc       360
     tccgtcctcg tcgaggagta ccgcgtcgcc gtgggcgcgc tcgtcgccca gctgacgccg       420
     cgggacctcg aacccgccct ggcggcggcg gagtcgcacg accccgcgtc cgcggcggga       480
     ggaagcgacc tgctgtccct cgccgagacg ttggagcggg cctaccggac ggccgcggcg       540
     gccgcctgcc ggaacgtctc cgtggccccc gcggtgcagc agcagctctg cgaccgcttc       600
     tccgcctacc tcacctacct cgccgccgcg gcccgggccc gctccgcaca tccgtccgcc       660
     cacgcgccca tcgccacgac cgtgctgtcc gccaccgctg acgccggccc ccgcaccgcc       720
     gacccgtgcg gcacgatcac ccggttcgcc gtgggaccgg accgtctcct cggggacccc       780
     gaagtggcgg cccacgtctc ccgggcgctg agcggatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page