(data stored in ACNUC7421 zone)

EMBL: AP009493.PE576

AP009493.PE576       Location/Qualifiers
FT   CDS_pept        664267..664491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_576"
FT                   /product="putative MbtH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_576"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17405"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI7"
FT                   /protein_id="BAG17405.1"
FT                   /translation="MTAGPHSDDPTVYRVVVNHEEQYSIWPADRPRPNGWDDTGHSGPR
FT                   ESCLAYIETVWTDMRPLSLRRRTGEEAAQ"
     gtgacggctg gaccgcacag cgacgacccg acggtgtacc gggtcgtcgt caatcacgag        60
     gagcagtact cgatctggcc cgccgaccgg ccgcgcccga acggctggga cgacacgggg       120
     cacagcgggc cgcgcgagag ctgcctggcg tacatcgaga ccgtctggac cgacatgcgg       180
     ccgctgagcc tgcgccgtcg gaccggagag gaggccgcgc agtga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page