(data stored in ACNUC7421 zone)

EMBL: AP009493.PE577

AP009493.PE577       Location/Qualifiers
FT   CDS_pept        664488..664733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_577"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17406"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI8"
FT                   /protein_id="BAG17406.1"
FT                   /translation="MKPYYRGFLLREVRAFADWAESATPEERDLPDDTVVYVRDDLAVV
FT                   RHPVQAEQGVLWDTATLRWRAFCTDELRFEPPVEQR"
     gtgaagccgt actaccgggg cttcctcctc cgcgaggtgc gtgccttcgc cgactgggcc        60
     gagtcggcca cgcccgagga gcgcgacctg ccggacgaca ccgtggtgta cgtgcgcgac       120
     gacctggccg tcgtacgcca tccggtgcag gccgaacagg gggtgctgtg ggacacggcg       180
     accctgcggt ggcgtgcctt ctgcacggac gagctgcggt tcgagccgcc cgtcgaacag       240
     aggtga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page