(data stored in ACNUC7421 zone)

EMBL: AP009493.PE578

AP009493.PE578       Location/Qualifiers
FT   CDS_pept        664739..665674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_578"
FT                   /product="putative SyrP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_578"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17407"
FT                   /db_xref="GOA:B1VRI9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI9"
FT                   /protein_id="BAG17407.1"
FT                   /translation="MDLPLVIEAQDDENLLHRTARDRAGIRRALRTNGAVLLRGFAVEG
FT                   VDGFEAAVRELSGGAPLPYEERSSPRSTIKGRVYTSTDYPPHEEIFFHNENSYRVSWPM
FT                   SLYFYCVEPPRRRGATPLSDTREVLRALDPAVREEFERRGWKVVRNFGSEFGLSWQEVF
FT                   NSGDRAQVERFCAANDVSVEWRPDGGLRTSSVRDAVHRHPETGEEVWFNHAAIFHLSTL
FT                   SPEIREGMLELFDEEDLPNNSYFGDGAAIPDNVMAHVRDCYRSAATRFDYARDDVLVVD
FT                   NMLTAHGREPFTRPRTIAVAMAEPGPGVRA"
     atggatctgc ccctcgtcat cgaggcacag gacgacgaga acctcctcca ccggacagcc        60
     cgggaccgcg ccgggatacg gcgggcgctg cgcacgaacg gcgccgtgct gctgcgcgga       120
     ttcgcggtcg agggggtgga cgggttcgag gcggcggtgc gggagctgtc cggcggggcc       180
     ccgctcccgt acgaggagcg gtcctcgccg cgcagcacga tcaagggccg ggtctacacc       240
     tccacggact acccgccgca cgaggagatc ttcttccaca acgagaactc ctaccgcgtc       300
     tcctggccca tgagtctgta cttctactgc gtcgagccgc cgcgccgccg gggcgcgacc       360
     ccgctgtccg acacccgcga ggtgctgcgc gccctcgacc ccgccgtgcg cgaggagttc       420
     gagcggcgcg ggtggaaggt ggtgcgcaac ttcggctccg aattcgggct gagctggcag       480
     gaggtcttca actccgggga ccgggcgcag gtcgaacggt tctgcgcggc caacgacgta       540
     tccgtcgaat ggcggccgga cggcgggctg cgcacctcgt cggtgcgcga cgcggtgcac       600
     cggcacccgg agacgggcga ggaggtgtgg ttcaaccacg cggccatctt ccacctctcc       660
     accctgtcgc cggagatccg cgagggaatg ctcgaactgt tcgacgagga ggacctgccc       720
     aacaacagct acttcggcga cggtgccgcc atccccgaca acgtcatggc gcatgtgcgc       780
     gactgctacc ggtcggcggc cacccgcttc gactacgccc gtgacgacgt cctggtcgtc       840
     gacaacatgc tcaccgcgca cggccgggag ccgttcaccc gcccccgcac catcgccgtg       900
     gcgatggccg agcccgggcc gggggtgcgg gcatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page