(data stored in ACNUC7421 zone)

EMBL: AP009493.PE588

AP009493.PE588       Location/Qualifiers
FT   CDS_pept        complement(684163..685278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_588"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRJ9"
FT                   /protein_id="BAG17417.1"
FT                   /translation="MSPPIRLSAAIMTHPARRARALALRDSLPELDLQVVEDPDPYGAG
FT                   SCSARTAVLAWGAVTPHATHHLVLQDDAVPVADLREQVLRRVGERPAAAISLYTEWASA
FT                   TSSAVHLAAWLGQPFAEVCDPYTPCIGLVLPAEAARELARTRPEVPQDDVMIAGVLRRL
FT                   GVPAYVTVPNLVQHATEASLTGNTPMGLRLAACYSTAPHSDTAPVVDARVDLLPCFSRS
FT                   YGRPYYLERDPGSVSGWSQRGLLETLRRRDVDVPALQRAAARRSAGLHRAEPDLRPDIV
FT                   VSLWITAWLGGTELRRLLRDHALAPAEVLDRRLGQIALANIGPGIFDQYMPPERLLELS
FT                   PVLEGFAQAAFTEGVTPSVTGHSPDHRSLNG"
     atgagtcccc ccatcagact ctccgccgcg atcatgaccc accccgcccg cagggcgaga        60
     gccctcgccc tcagggacag ccttccggag ctggacctcc aggtcgtcga ggatcccgac       120
     ccctacggcg ccggctcctg ttcggcgagg accgcggtgc tcgcgtgggg ggcggtgacc       180
     cctcacgcca cccaccacct ggtccttcag gacgacgccg tccccgtcgc ggacctgcgg       240
     gagcaggtac tgcgcagggt cggtgagcgg ccggccgccg cgatcagcct ctacacggaa       300
     tgggcttcgg ccacgtcgtc cgccgtccac ctcgcggcct ggctcggaca gcccttcgcc       360
     gaggtgtgcg acccgtacac accctgtatc ggactcgttc tgccggcgga ggcggcccgc       420
     gaactggcga ggacgagacc ggaggttccg caggacgacg tcatgatcgc cggcgtgctg       480
     cgccggctcg gggtccccgc atacgtgacc gttcccaatc tggtccagca cgcgaccgag       540
     gcgagtctca ccggcaacac cccgatggga ctgcggctgg ccgcctgcta ctccaccgcg       600
     ccccacagcg acaccgcgcc ggtcgtggac gcccgggtgg acctgctgcc ctgcttctca       660
     cgctcgtacg gaaggccgta ctacctggaa cgggaccccg gcagcgtctc gggctggtcg       720
     cagcgcggcc tgctcgagac gctgcggcgg cgagacgtgg acgtgcccgc actgcaacgc       780
     gcggcggcac gccggtcggc gggtctgcac cgggccgaac cggatctgcg gcccgacatc       840
     gtcgtcagcc tgtggatcac cgcatggctg gggggtacgg aactccgtcg gctcctccgc       900
     gaccacgccc tggccccggc cgaggtgctc gaccggagac tggggcagat cgcgctggcc       960
     aacatcggcc ccgggatctt cgaccagtac atgccgccgg aacgactcct ggaactgtca      1020
     cccgtcctgg agggctttgc ccaggcggcc ttcaccgagg gcgtgacgcc gtccgtgacg      1080
     ggccattccc ccgaccaccg gtcactcaac ggctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page