(data stored in ACNUC7421 zone)

EMBL: AP009493.PE590

AP009493.PE590       Location/Qualifiers
FT   CDS_pept        complement(687038..687763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17419"
FT                   /db_xref="GOA:B1VRK1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK1"
FT                   /protein_id="BAG17419.1"
FT                   /translation="MINETDLWSLAKRALAPADRPAEHNPPQWPPAQDTSRISRSVPLH
FT                   DVLTARRSVRRFREDPVPDTDLATLLDLATSTDRQMWPHGTAATTPQAWLVSGVAGTSG
FT                   ARLRQYVPRRSPAGAATAVEPLAGEFTDHGDCPEPALLAARYAPAPVTVLICAEITDDT
FT                   GTAADDTGSDYGRALLRASAFGYNAWLSAVAAGLGGSVHGRSSPEVTRIVRRHTGTPAR
FT                   HLFTLVLGHPAESPQEFGP"
     ctgatcaacg agaccgacct gtggtcgctg gcgaagcgtg ctctcgcccc cgccgaccgc        60
     cccgccgagc acaaccctcc tcagtggccg ccggcccagg acacctcccg gatctctcgg       120
     agcgtgccgc tccacgatgt gctgacagcc cgtcgatcgg tccgccgctt ccgggaggac       180
     ccggtgcccg acaccgacct cgccaccctt ctggatctgg ccacgtcgac cgaccggcag       240
     atgtggccgc acggcacggc cgcgaccacc ccgcaggcat ggctcgtcag cggcgtggcg       300
     ggtacctcgg gagcgcggct gcgccagtac gtcccgcggc ggtccccggc aggagcggcc       360
     acggcggtgg agcctctcgc gggggagttc accgaccacg gcgactgccc cgaaccggcc       420
     ctgctcgccg cgcgttacgc cccggccccg gtgacggtcc tgatctgcgc ggagatcacc       480
     gacgacaccg gcaccgcggc cgacgacacc ggctcggact acgggcgggc gctcctgcgg       540
     gcgtcggcct tcggctacaa cgcgtggctt tcggcggtcg cggcgggtct cggcggcagc       600
     gtgcacggcc gttcctcacc cgaggtgacc cgcatcgtgc gccggcacac gggcacaccg       660
     gccaggcacc tgttcaccct tgtgctcggc catcctgccg aatccccgca ggagttcgga       720
     ccgtga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page