(data stored in ACNUC7421 zone)

EMBL: AP009493.PE591

AP009493.PE591       Location/Qualifiers
FT   CDS_pept        complement(687760..689412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_591"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17420"
FT                   /db_xref="GOA:B1VRK2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK2"
FT                   /protein_id="BAG17420.1"
FT                   /translation="MAVSAADGQVVFSAGQIRKRIGGGDALRLLLPIASAMDGRRTVGD
FT                   LAEATDLPYEAVAQAVALLVKQGLVLSGEVSSPKPLAAGVVDYLEQTAGSSATFRDASE
FT                   VLERLSRCAVLIVAPPGHTEAVRDDLAMSGVGTVHSASTPAGVGNEVLDSLRAAAGSLV
FT                   VLYGPPRHDDGTDSFTDDCAARDIAVLHYAAHQGQVDLGPLVHPRATLCRRCFTSGYLA
FT                   EFGSEQPAPADTATTTVAAGLVVGEALAYLADVDSMRTSQALVRWTLPDSTAVRYAVSA
FT                   EAGCASCATTSRRSGERATVLEAYEDVVAAQPLADRPQPPVTAGRKKRLTALGKERESF
FT                   PTAPVIPLPPPPVTASAAPTGDEAPAVSEAGPSGTVGTADAAFVADLAAMVAGRRGDGG
FT                   PRRWTASGGELASVELYLMCADTVSGLPAHTLLKYDDVAHRLLVTRRTHGPGLWRSMLD
FT                   ATGITETADVVLVVVGALWRLKLKYSTFGIRLGHLDAGCALAQLHAVATDRGARVTLND
FT                   RWQPTLPTLLELKEDEQVMAVAGLWTPRSARCH"
     gtggcggtct ccgccgccga cggccaggtc gtcttctcgg ccggacagat ccgcaagagg        60
     atcggcggtg gggacgccct ccggctcctg ctgccgatcg cgtcggcgat ggacggacgc       120
     cgcacggtcg gcgacctcgc cgaagcgacg gaccttccgt acgaggcggt ggcccaggcc       180
     gtggcactgc tggtgaagca gggcctcgtc ctctccgggg aggtctcatc gccgaagccg       240
     ctggcggccg gcgtcgtcga ctacctggaa cagaccgctg gttcctcggc cacgttccgc       300
     gacgcctccg aggtactgga acgcctgtcg cgatgcgcgg tgctgatcgt cgccccaccg       360
     gggcacacgg aagccgtccg cgacgacctg gcgatgagcg gcgtcggaac agtccacagc       420
     gcgtccacgc cggccggagt cgggaacgag gtgctcgaca gcctgcgggc agcggcgggc       480
     agcctcgtgg tgctgtacgg cccgccccgc cacgatgacg gcacggacag cttcaccgac       540
     gactgcgcgg cccgcgacat cgcggtactg cactacgcgg cgcaccaggg gcaggtcgac       600
     ctcggtccgc tggtgcatcc gcgggcgacg ctgtgccgac gctgcttcac cagcggctac       660
     ctcgcggagt tcggaagcga acagccggcc ccggccgaca ccgccacgac gacggtcgcc       720
     gccggactcg tggtgggcga agcgctggcc tacctggccg acgtcgacag catgcgcacc       780
     agtcaggctc tcgtccgctg gaccctgccg gactccaccg cggtgcggta cgcggtctct       840
     gccgaggccg gctgcgcatc gtgcgcgacg acgtcccgcc gctcgggaga gcgtgcaacc       900
     gtactggagg cgtacgagga cgtcgtcgcc gcgcaaccgc tcgccgaccg gcctcagcct       960
     ccggtcaccg ccggccggaa gaagcgcctg acggcgctgg gcaaggaacg cgagtcgttc      1020
     cccaccgcac cggtgatacc gctgcctccg ccaccggtga ccgcgtccgc cgccccgacc      1080
     ggtgacgagg cgccggccgt gtccgaggcg ggcccgtccg ggacggtggg gaccgccgac      1140
     gcggcattcg tcgccgacct ggcggcgatg gtggcgggac ggcgcgggga cggcggaccc      1200
     cgcaggtgga ccgcgtccgg gggagaactc gcgtcggtcg agctgtatct gatgtgcgcg      1260
     gacacggtct ccgggctgcc cgcacacacc ctcctgaaat acgacgacgt cgcccaccgg      1320
     ctcctcgtca cccgccggac ccacgggccc ggcctatggc ggtccatgct cgacgcgacc      1380
     gggatcacgg agactgcgga cgtcgttctg gtcgtcgtcg gcgcgctctg gagactgaag      1440
     ctcaagtaca gcactttcgg gatccggctg gggcacctcg acgccgggtg cgccctcgcg      1500
     caactgcacg cggtggccac cgaccgagga gcacgcgtca ctctgaacga ccgctggcag      1560
     ccgacgctgc cgacgttgct ggaactcaag gaagacgaac aggtcatggc cgtggccggc      1620
     ctgtggaccc cgcggagcgc gcgatgccac tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page