(data stored in ACNUC7421 zone)

EMBL: AP009493.PE592

AP009493.PE592       Location/Qualifiers
FT   CDS_pept        complement(689453..690049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_592"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17421"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK3"
FT                   /protein_id="BAG17421.1"
FT                   /translation="MLVDADAAVLVLDRPARRLARRFRQVASEAGKPWLLVEFDHPVIR
FT                   VGPYFDPAAGPCLDCFYAREDQHADKPAPLREPAPGHEHEHTHEHNHGHAHAPDCSHTS
FT                   APASAEEGLGVEAAAGVLPHQARIAAGLLSLSLTEQVRGRVVTVDLRTAAVRSDQVIGC
FT                   HGCPHCGDETQRTLMSRQLDHLFRTVGGVTHDEHR"
     atgctcgtcg atgccgacgc agcagtgctg gtactggacc gccccgcccg gcggttggca        60
     cgccgattcc ggcaggtggc ctccgaggcg ggaaagccgt ggctcctggt ggagttcgat       120
     caccccgtca tcagagtggg accgtacttc gatcctgcgg ccggcccgtg cctggactgt       180
     ttctatgcgc gtgaggacca gcacgccgac aagccggctc ccctccggga acccgcaccc       240
     gggcacgagc acgagcacac gcacgagcac aaccacggac acgcccacgc accggactgt       300
     tcgcacacat cggcgcccgc gtcggcggag gaaggactcg gcgtcgaggc ggcggccggg       360
     gtcctgccgc accaggcgcg catcgccgcg gggctgctga gcctgtcgct gaccgagcag       420
     gttcgcgggc gggtggtcac cgtcgatctc cgcacggcgg cggtccgctc ggaccaggtg       480
     atcggctgcc acggctgccc gcactgcggc gacgagaccc aacgcacgct catgtcgcga       540
     cagctcgatc acctgttccg taccgtggga ggcgtcactc atgacgagca ccgatag          597
//

If you have problems or comments...

PBIL Back to PBIL home page