(data stored in ACNUC7421 zone)

EMBL: AP009493.PE593

AP009493.PE593       Location/Qualifiers
FT   CDS_pept        complement(690160..691515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_593"
FT                   /product="hypothetical protein of YcaO-like family"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_593"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17422"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK4"
FT                   /protein_id="BAG17422.1"
FT                   /translation="MAPVGGCHPDKEPRCSLPDLNDVNMKHLDPLLSRYGVVGDAFDLS
FT                   PSRYRGLPELSSYGVDLGSGFPGFEARPDDRVVAGGHALGDKDRARLLAIAEGCERYSG
FT                   AQFGTEGVVTAAAHDLDGRVLDWSRIPRLSDAEYAHPRCPLVPFDPAAPIRWVRGVDLR
FT                   DGNPTWLPLSMAAYRSGRRFPAERFVASISTGCAVHTDPASAVFGGLSEVVERDMIAVL
FT                   WLQKLPLPHIPLDVLDERERTLVEWAHDRFLNTVLLDATSDIGVPTVYCMQTAPHDQTL
FT                   RTMVGCGTGLTIQDAAYKALLEVTCFRDSLHVEWEEPVSFADYTDISDGAKYMGKPENA
FT                   PHFAFLTDDHPDRPSFQDRGRYAADATEGLARAVRRFAELDMAVIAVDRTTTELASVGL
FT                   HSATVVIPDLQPMSPVPLAQYHAHPRLYSAPAAMGYRVLPVEELNPCPQPFA"
     gtggcacccg tcggcgggtg ccacccggac aaggaaccac ggtgttcctt gcctgacctg        60
     aatgacgtga acatgaaaca tcttgatccg cttctctcgc gctacggcgt cgtcggggac       120
     gccttcgacc tctccccgtc ccgctatcga ggtctgccgg aactgagctc ctacggggtc       180
     gatctcggca gcggcttccc gggcttcgag gcacgcccgg acgaccgggt cgtggccgga       240
     ggacatgcgc tgggagacaa ggacagggca cgcctgctcg ccatcgccga gggatgcgag       300
     cgctactcgg gggcgcagtt cggcacggag ggcgtagtga ccgccgccgc gcacgatctc       360
     gacggcaggg tgctcgactg gtcgcggatt ccgcgtctgt ccgacgcgga gtacgcgcat       420
     ccgcggtgcc cgctcgtccc tttcgatccg gccgcgccga tcaggtgggt ccggggggtg       480
     gatctccggg acgggaaccc cacctggctg ccgctctcca tggcggccta ccggtcgggg       540
     cgccgtttcc cggccgagcg cttcgtggcg agcatctcga caggctgcgc cgtgcacact       600
     gatcccgcga gtgccgtctt cggcggcctg agcgaggtcg tcgagcggga catgatcgcc       660
     gttctgtggc tacagaagct gccgctgccg cacattcctc tcgacgtgct ggacgagcgg       720
     gaacgcaccc tggtcgagtg ggcgcacgat cgcttcctca acaccgtgct gctggatgcc       780
     accagtgaca tcggtgtacc cacggtgtac tgcatgcaga ccgcaccgca tgaccagacc       840
     ctgcgcacca tggtcgggtg cggtaccggg ctcaccattc aggatgccgc gtacaaggcg       900
     ttgctggaag tcacgtgctt ccgtgactcg ctgcacgtgg agtgggagga gcccgtgtcc       960
     ttcgccgact acaccgatat ctcggacggc gcgaaataca tgggcaagcc ggagaatgcc      1020
     ccacacttcg cattcctcac cgatgaccac cccgaccggc cctcgttcca ggaccgcggc      1080
     cgttacgccg ccgacgccac tgaggggctg gcccgcgctg tccggaggtt cgccgagctg      1140
     gacatggcgg tgatcgccgt ggaccggacg acgacggaac tcgcctcggt cggactgcac      1200
     tcggcgaccg tcgtcatccc ggacctccag ccgatgtccc ctgtgccgct cgcccagtat      1260
     cacgcgcatc cccggctcta ctccgccccc gcggcgatgg gatatcgcgt actgcctgtc      1320
     gaggagttga acccgtgtcc gcagccgttc gcctga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page