(data stored in ACNUC7421 zone)

EMBL: AP009493.PE594

AP009493.PE594       Location/Qualifiers
FT   CDS_pept        complement(692263..692799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_594"
FT                   /product="putative pyridoxamine 5'-phosphate
FT                   oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_594"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17423"
FT                   /db_xref="GOA:B1VRK5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK5"
FT                   /protein_id="BAG17423.1"
FT                   /translation="MPDRDPIAEIGPFSDARADATPWPTALRVLEQARLFWLSTVRPDG
FT                   RPHVTPLLAVWNGGALYFATGDQERKARNLQGNHHCVMTTGTNVLDGLDITIEGLAESV
FT                   SDPTERGTAADAYEDKYGDLLTSPDGTWYGLGDTIRVGDVLLYRIDPAVGFAFGKGAVY
FT                   SQTRYRFHHGSSEQR"
     atgcccgacc gtgacccgat cgccgagatc ggacccttca gcgacgcacg cgccgacgcg        60
     accccctggc cgaccgccct gcgtgtgctg gagcaggcgc ggctgttctg gctgtccacc       120
     gtccgccccg acggccgacc ccacgtgacg ccgctgctgg ccgtctggaa cggcggcgct       180
     ctgtacttcg cgaccggtga ccaggagcgt aaggcgcgca acctccaggg caaccaccac       240
     tgtgtgatga caacgggcac gaacgtcctg gacggtctcg acatcaccat cgaaggactg       300
     gccgagtcgg tgagcgaccc gacagaacgc ggcactgccg cagacgccta cgaggacaag       360
     tacggcgacc tgctgacgag ccccgacggc acctggtacg gcctcggtga caccattcgc       420
     gtcggcgatg tcctgctgta ccgcatcgac ccggcggtcg gattcgcctt cgggaaaggc       480
     gcggtgtaca gccagacccg ctatcgcttc caccacggat cctccgaaca gcggtga          537
//

If you have problems or comments...

PBIL Back to PBIL home page