(data stored in ACNUC7421 zone)

EMBL: AP009493.PE596

AP009493.PE596       Location/Qualifiers
FT   CDS_pept        complement(693187..694356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_596"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17425"
FT                   /db_xref="GOA:B1VRK7"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK7"
FT                   /protein_id="BAG17425.1"
FT                   /translation="MLRGTCNRTRVPREGSILVTPFLEAGMYDAIVAARAVVCGSGGLT
FT                   GHMQSLCRGRGIPVLRVDEADLADLVGEVTLYLESASIVVGPEESAPPGTGRSAMDDLG
FT                   SACAVIADLQDITTINSSGPDAARVESFFIREEFLCLALGLSPLDAMAGGPAGITAYGQ
FT                   AIGGRLRGFVEALLPGQRLILRMLDLRSDHAAEVSEIAPVAVEPNPEMGLHGARWLLRS
FT                   VAYRDALHVVLSTLRKHLGDQADRVVLSVPFVRDETEFVQLRAHLDLPDEAPLSAFVET
FT                   PSAVYATPAMCAAGVSELFVGIKDLVQFYLAADRGNHLVADSYSTRHPAVLDGVRRVVE
FT                   CSRAAGTPVRVFSLASDLDHYLEHLPTPDGYMMCTAELRQLLLRHSTRT"
     gtgctccggg gcacctgtaa tcggacaaga gttccacgcg agggcagcat cctcgtcacc        60
     cccttccttg aggcagggat gtacgacgcc atcgtggccg cacgcgcggt ggtctgcggc       120
     tccggcggac tgaccggcca catgcagtcc ctgtgccgtg gcagagggat acctgtcctc       180
     cgtgtcgacg aggcggacct cgccgacctg gtcggcgagg tgacgctgta cctggagagc       240
     gcgtcgatcg tcgtcggacc cgaggagtcg gcgccgcccg ggaccgggag gtccgcgatg       300
     gacgacctcg gctcggcgtg cgcggtcatc gcggacttgc aggacatcac caccatcaac       360
     tcctccgggc cggacgccgc acgggtcgag tccttcttca tccgggagga gttcctctgc       420
     ctcgcgctgg gcctgagccc gctcgacgcc atggccggcg gcccggccgg catcaccgcc       480
     tacggacagg ccataggagg gcggctccgc ggcttcgtcg aggcgctcct gcccggccag       540
     cgcctgatcc tgcggatgct cgacctgcgc tccgaccacg cggccgaagt cagcgagatc       600
     gccccggtcg cggtggagcc gaaccccgag atggggctgc acggcgcccg ctggctgctg       660
     cgctccgtcg cctaccgcga cgccttgcac gtcgtccttt ccacgctgcg caagcacctc       720
     ggagaccaag ccgacagagt ggtgctctcg gtgccgttcg tccgcgacga gaccgagttc       780
     gtgcagctcc gagcacacct cgacctgccg gacgaggccc ccctgtccgc gttcgtcgag       840
     acgccctccg ccgtttacgc caccccggcg atgtgcgcgg ccggtgtcag cgaactgttc       900
     gtcggcatca aggacctggt gcagttctat ctggcggcgg accgcggcaa ccacttggtc       960
     gccgactcct acagcacccg tcacccggct gtcctggacg gggtccgcag ggtcgtggaa      1020
     tgcagccgcg ccgcgggtac cccggtgcgg gtcttctccc tggcgtccga tctcgaccac      1080
     tacctggagc acctgcccac ccccgacggg tacatgatgt gcaccgccga actccggcaa      1140
     ctgctcctgc gccattccac caggacctga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page