(data stored in ACNUC7421 zone)

EMBL: AP009493.PE597

AP009493.PE597       Location/Qualifiers
FT   CDS_pept        complement(694414..696315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_597"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17426"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK8"
FT                   /protein_id="BAG17426.1"
FT                   /translation="MNRTGACPRVLVVGAGLAGTATAIRLLHFARRPLEIVLLERRPDY
FT                   RSAGVAYHRDGNPWDYVFNIQAGRMSVFREDVLDFISWANQEADRRDWPQHWAGHTFTE
FT                   QGPAPRRIFQDYLDDRLAEARRQSCPGVVLVEADGEALDMDACDRGYEVTVGGLSATGL
FT                   DSVRSGPLPDTKVVGADHVVLATGLELKDPPFAVEVSGHPSFVRNPYSAAGIRTLSRLP
FT                   PEATVAIVGSVLSAYDSAGLLLRNGHTGQILLISRSGTIFRTYPGTHEHGVVRLPRPET
FT                   LMEPYRDREEFLARGRAAWRAACSTVRERHPGIASAIVPERVAKAWEPYLPEIIERIPD
FT                   EELRLLLDEFATTIAALRVGAVEYTMAIIEHAMRSPEGSVELVVGKVRAITPTRSGRLL
FT                   VSVAGQHGGHGVEADLVVSNFGRESDYAKVGQPLWRALLGKGIATPHERTGRGLEVDAC
FT                   GTLLDADGRPVGPVSAIGVLREGDEIVRHGRTGAFAFNLAAIKNHSVSVAAHVTEQLEL
FT                   RQEGLSDIAALHPHYRSYASNPEEADRAALEEAVVLEVRRLATRERKKREALDSRLTAS
FT                   ILSIGGLPALPAAVSRPDRLMRAVVNRVAAERLNDVSVTPRQLRRQLGIGNVDNPEG"
     atgaatcgaa cgggcgcgtg ccccagagtg ctcgtcgtgg gcgccggcct ggccggcacc        60
     gcgacggcga tccggctcct ccacttcgcg cgcagaccac tggagatcgt tctgctggag       120
     cgccgccccg actaccgttc cgccggagtc gcctatcacc gtgacggcaa cccctgggac       180
     tacgtcttca acatccaggc cggccggatg tccgtgttcc gcgaggacgt cctcgacttc       240
     atcagctggg ccaaccagga ggccgaccga cgggactggc cgcagcactg ggccgggcac       300
     acgttcaccg aacagggccc ggctccccgg cgcatcttcc aggactacct cgacgaccgg       360
     ctggccgagg ccagaagaca gtcctgcccc ggcgtcgtcc tcgtcgaagc ggacggcgag       420
     gcgctcgaca tggacgcgtg cgaccggggc tacgaggtga ccgtcggcgg cctctccgcg       480
     accgggctcg acagcgtgcg ctccggtccg ctcccggaca cgaaggtggt cggcgccgac       540
     cacgtggtcc tcgccaccgg cctcgaactc aaggatccgc ccttcgcggt cgaggtctcc       600
     ggacacccct ccttcgtacg caatccgtac tccgcggccg gaatccgcac gctctcccgg       660
     ctcccgcccg aagccaccgt cgccatcgtc ggatccgtac tgagtgcgta cgactcggcg       720
     ggactgctgc tgcgcaacgg ccacaccggg cagatcctcc tcatctcccg gtccgggacg       780
     atcttccgca cctatcccgg cacccacgaa cacggcgtgg tgcgcctgcc ccgccccgag       840
     accctgatgg agccctaccg cgaccgcgag gaattcctgg cacggggcag ggccgcatgg       900
     cgtgcggcgt gctcgacggt gcgcgagagg caccccggca tcgcctccgc catcgtcccc       960
     gaacgcgtcg ccaaagcgtg ggagccgtat ctccccgaga tcatcgagcg tatcccggat      1020
     gaggaactgc gcctcctgct ggacgagttc gccaccacca tcgcggcgct gcgcgtcggc      1080
     gccgtggagt acacgatggc gatcatcgag catgcgatgc ggtcgccgga ggggtcggtg      1140
     gagctggttg tcggcaaggt gcgggccatc acgcccacaa ggtcggggcg gctgctggtc      1200
     tcggtcgccg ggcagcacgg cggccacgga gtcgaggccg atctggtggt gtccaacttc      1260
     ggcagggagt ccgactacgc caaggtagga cagccgctgt ggcgagcgct gctggggaag      1320
     ggcatcgcga ccccccacga gcgcaccggg cgcggcctgg aggtcgacgc gtgcgggacc      1380
     ctgctggacg ccgacgggcg accggtcggc ccggtctccg cgatcggcgt gctgagggag      1440
     ggcgacgaga tcgtccggca cggccgaacg ggcgcgttcg cgttcaacct cgccgccatc      1500
     aagaaccact cggtctccgt cgcggcccat gtgaccgagc agttggaact gcgacaggag      1560
     ggcttgagcg acatcgcggc cctgcacccc cactaccgga gctatgccag caatccggag      1620
     gaagcggacc gggcggcctt ggaggaggct gtggtactgg aggtgcggag gctggccacg      1680
     cgcgaacgga agaagcgaga agcgctcgac tcccgcttga ccgcgagcat cctctccatc      1740
     ggcggtcttc cggcactccc ggcagctgtc tcccggcccg accgcctgat gagggcggtc      1800
     gtcaaccggg tcgctgcgga acggctcaac gacgtctccg tgacgccacg gcagctacgt      1860
     cgacaactgg ggatcgggaa cgtcgacaat ccggagggct ag                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page