(data stored in ACNUC7421 zone)

EMBL: AP009493.PE598

AP009493.PE598       Location/Qualifiers
FT   CDS_pept        complement(696451..696999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_598"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17427"
FT                   /db_xref="GOA:B1VRK9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK9"
FT                   /protein_id="BAG17427.1"
FT                   /translation="MPRIPVHTVDSAPAPGGETLRRLEKRFGRVLNIHGGMAHSPVVLA
FT                   TYAAMSTAIAEHGTFDARTREAIALAVGAVDACAYCQSAHTVSARAAGFTEEQTVAIRR
FT                   GERGDDPKLDALVQVAREVAGEVGEASDAAWDEAAAQGWTDTQLTEVFAHVAVNLYTNY
FT                   FNHYVRTELDVPAAPGLDG"
     gtgccgcgga ttcctgtcca caccgtcgac agcgcgcccg cacccggcgg ggagactctg        60
     cgccgcctgg agaagcgatt cgggagggtg ctcaacatcc atggagggat ggcccactcg       120
     cccgtggtcc tggcgaccta cgcggcgatg agcacggcca tcgccgagca cggcaccttc       180
     gacgcccgca cccgcgaggc gatagccctg gccgtgggag cggtcgacgc ctgcgcgtac       240
     tgccagtcgg cacacacggt gtcggcaagg gcggcgggct tcacggagga gcagaccgtg       300
     gcgatccggc gcggagagcg cggcgacgat ccgaagctcg acgctcttgt ccaggtcgcg       360
     agggaggtcg ccggagaggt cggcgaggcg tccgacgcgg cgtgggacga ggccgctgcc       420
     cagggctgga cggacaccca gctgaccgag gtgttcgccc acgtggcggt gaacctctac       480
     accaactact tcaaccatta cgtccgtacg gaactcgatg tcccggcagc cccgggcctc       540
     gacggctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page