(data stored in ACNUC7421 zone)

EMBL: AP009493.PE599

AP009493.PE599       Location/Qualifiers
FT   CDS_pept        697799..698602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_599"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17428"
FT                   /db_xref="GOA:B1VRL0"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL0"
FT                   /protein_id="BAG17428.1"
FT                   /translation="MSDLANVLKDLATAGDETDRMVADLDDAQWALDTPAPGWTVTDQI
FT                   AHLVFVYRLAGTAAADPEAFRAMTEKASGDFDGAVNAALAAYRSGTPQALLDRWRAERA
FT                   ATIEALAAVPPGQTVPWLVNPLPPVVLACAGLMETFAHGQDIADTIGVRRDPAPWLRHV
FT                   AGFAVLTQAFGYEARGLTPPSEPFRFELTSPTGELWEYGPPEAAHRITGPAHDFCLLVT
FT                   RRRHRDDLALTATKGAADHWLDIAQAYRGPAGEGRRPGQFSDTSR"
     atgtccgact tggcgaacgt gctcaaggac ctggcgacgg cgggagacga gaccgaccgt        60
     atggtggccg acctcgacga cgcccaatgg gcgctggaca ctccggcccc cggctggacg       120
     gttaccgacc agatagccca cctcgtcttc gtctatcggc tcgccggtac ggcggcggcc       180
     gacccggagg cgttccgggc catgaccgag aaggcctccg gcgacttcga cggagcggtc       240
     aacgccgcac tggccgccta ccgctccggc accccgcagg cactcctcga ccgctggcgc       300
     gccgagcgcg cggccaccat cgaggcgctc gccgccgtcc ccccgggaca gacggtgccg       360
     tggctggtga acccgctgcc gccggtcgtg ctcgcctgcg cgggcctcat ggagaccttc       420
     gcccacggtc aggacatcgc cgacaccatc ggcgtgcgcc gcgatccggc gccgtggctg       480
     cgccacgtgg ccggattcgc cgtgctgacc caagccttcg gctacgaggc acgcggcctg       540
     accccgccca gtgaaccttt tcgcttcgaa ctcacctctc cgacaggcga gttgtgggag       600
     tacggccctc cggaggcggc ccatcggatc acgggtcccg cccatgactt ctgcctgctc       660
     gtcacccggc gtcgccaccg cgacgacctt gccctcacgg ccaccaaggg tgcggcggat       720
     cactggctcg acatcgcgca ggcctaccgg ggcccggccg gagagggccg caggcccggc       780
     cagttctccg acacgtcccg gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page