(data stored in ACNUC7421 zone)

EMBL: AP009493.PE601

AP009493.PE601       Location/Qualifiers
FT   CDS_pept        complement(700856..701341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_601"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17430"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL2"
FT                   /protein_id="BAG17430.1"
FT                   /translation="MAGVVPWPGAVAAGALELLQTAATGMSDSLEAFADALNAHAERLH
FT                   AQSRPDPAGEPAERDPGVPPFVALSFAERTRLVVILTAPGHPERHLWVSLALFSNMAFD
FT                   TGAHLHTADAIAAGHPGLAALGFAPPSDDGQWRFSEFSYGRPLARLHPDTTPSGSLA"
     gtggccggcg tcgtaccctg gcccggggcc gtggctgccg gagccctcga actgctccag        60
     accgccgcca ccgggatgtc cgactctctg gaggccttcg ccgacgccct gaacgcgcac       120
     gccgaacgcc ttcacgcgca gagccggccg gaccctgccg gggagccggc cgagcgggac       180
     cccggggtcc cgcccttcgt ggcactgtcc ttcgccgaac gcacgcgact ggtggtcatc       240
     ctgaccgccc ccggccaccc cgaacgccat ctgtgggtca gcctcgccct gttcagcaac       300
     atggccttcg acaccggtgc ccacctgcac accgccgacg cgatcgccgc cgggcacccg       360
     gggctggccg ccctgggctt cgcacctccg tccgacgacg ggcagtggcg cttctccgag       420
     ttctcctacg gtcgccctct cgcccggctc caccccgaca cgaccccctc cgggagcctg       480
     gcgtga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page