(data stored in ACNUC7421 zone)

EMBL: AP009493.PE61

AP009493.PE61        Location/Qualifiers
FT   CDS_pept        65873..66136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_61t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_61t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16890"
FT                   /db_xref="GOA:B1VLY9"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLY9"
FT                   /protein_id="BAG16890.1"
FT                   /translation="MCARTYEFTDAEGRARRLTDDYTCGERVEILHDPAPDGDTARIGR
FT                   GTTGTLVFAGCVCLLSLVMAAALVAIGLARPHAALDVISPGL"
     gtgtgcgccc ggacctatga gttcaccgac gccgaggggc gcgcccgccg cctcaccgac        60
     gactacacgt gcggcgagcg agtggagatc ctccacgatc ccgccccgga tggggacacg       120
     gcccggatcg gccgcggcac cacgggaact ctggtcttcg ccggctgtgt ctgcctgctg       180
     tccctcgtca tggccgcggc cctggtcgcc atcggtctgg cgaggccgca cgccgctctg       240
     gacgtcatct cccctggcct gtag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page