(data stored in ACNUC7421 zone)

EMBL: AP009493.PE612

AP009493.PE612       Location/Qualifiers
FT   CDS_pept        717867..718904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_612"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17441"
FT                   /db_xref="GOA:B1VRM3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM3"
FT                   /protein_id="BAG17441.1"
FT                   /translation="MRPLVRAVLRGSLRQVRYVDVIAPHRARGLVAQVYRATERDFGVL
FT                   APPVALHSPAAASLAATWLMLREVLLVDGRVSRAVKETVATAVSRANDCPYCVHVHQAV
FT                   LGTLPPDRTVSPVAEWAAAAGRRHPGDPAGSAPPPFTEAQLPELCGVVVTFHYINRMVS
FT                   VFLADSPMPALTPAPLRAPIMRTTALAMRPVTPGPMAPGASLDLLPAAPLPPGLEWALG
FT                   SPPVAEAFGRAFAAVDQGARWVPKPVRERLRSRLDRWDGSAPGLGRAWLDEAVSALPAE
FT                   DVPAARLVLLTAFAPHQTLPEDVAAFRVRFPTDRELVELTSWAALTTAVRIGGRLLPSR
FT                   PARPA"
     atgagaccgc tcgtacgggc cgtgctgagg ggttccctgc ggcaggtgcg gtacgtggac        60
     gtgatcgccc cacaccgtgc ccggggcctg gtggcgcagg tgtaccgggc aacggagcgg       120
     gacttcgggg tgctcgcacc gccggtggcc ctccactcgc cggccgccgc gtcgctggcg       180
     gcgacgtggc tgatgctgcg tgaggtcctg ctggtggacg ggcgggtgag ccgcgcggtg       240
     aaggagacgg tcgccaccgc ggtctcacgc gccaacgact gcccgtactg cgtccatgtg       300
     caccaggcgg ttctcgggac gctgccgccg gacaggacgg tctccccggt cgccgagtgg       360
     gccgcggcgg ccggacggcg ccacccggga gacccggccg ggagcgcccc gcccccgttc       420
     accgaagcac agctgccgga actctgcggc gtcgtggtga cgtttcacta catcaaccgc       480
     atggtgagcg tcttcctcgc cgactccccc atgcccgccc tgacaccggc acctctgcgt       540
     gccccgatca tgcggaccac ggccctggcc atgcgtcccg tcactccggg cccgatggcg       600
     ccgggcgcct cgctggatct cctgcccgcg gcccccctgc ccccgggact ggagtgggcc       660
     ctgggcagtc ctcccgtggc cgaggccttc gggcgggcct tcgccgccgt ggaccagggg       720
     gcccgctggg tgccgaaacc ggtccgggag aggctgcggt cacgcctgga ccggtgggac       780
     ggttccgctc cggggctcgg ccgggcctgg ctcgacgagg ccgtgtcggc gctgccggcc       840
     gaggatgtgc ccgccgcccg gctcgtcctg ctgaccgcct tcgctccgca ccagaccctc       900
     ccggaggacg tcgcggcgtt cagagtccgg ttccccaccg accgcgagct cgtcgagctg       960
     acgtcctggg ccgccctgac caccgcggtg cggatcggcg gcaggctcct cccgtcccgc      1020
     cccgcccggc cggcgtga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page