(data stored in ACNUC7421 zone)

EMBL: AP009493.PE614

AP009493.PE614       Location/Qualifiers
FT   CDS_pept        complement(719883..720434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_614"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17443"
FT                   /db_xref="GOA:B1VRM5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM5"
FT                   /protein_id="BAG17443.1"
FT                   /translation="MPHIALGNDLPGITGLMAHRPDTAGPLGDLANALLRAPSSLDPGE
FT                   RELIAAYVSRLNDTEFCASSHGAFAAAQLAGGQQLVRAVLADPATAPVSGRLRALLNVA
FT                   AEVQGSARPVSDRTIAAARAEGADDTDLHDTVLIAAAFCMYNRYVSGLATELPKDDEYY
FT                   RHSARRIVADGYRGGIVRGD"
     atgccccaca tcgcactcgg caacgacctt cccggaatca ccggcctgat ggctcaccgt        60
     cccgacaccg ccggtccgct gggcgacctc gcgaacgccc tgctgcgagc gccgtcctcg       120
     ctcgacccgg gagagcggga gctgatcgcg gcgtacgtct cgcggctcaa cgacaccgag       180
     ttctgcgcct cctcgcacgg cgccttcgcc gccgcgcagt tggcgggagg tcagcagctg       240
     gtccgggccg tcctggccga ccccgcaacc gcaccggtca gtggccggct gcgggcgctg       300
     ctgaacgtgg cggccgaggt ccagggttcc gcacgtccgg tctccgaccg gacgatcgcg       360
     gcggcccgcg ccgagggcgc ggacgacacg gacctgcacg acaccgtgct gatcgccgcg       420
     gcgttctgca tgtacaaccg ctacgtcagc ggcctcgcca ccgagctgcc caaggacgac       480
     gagtactacc ggcactccgc ccggcggatc gtggccgacg gctaccgggg cgggatcgtc       540
     cggggcgact ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page