(data stored in ACNUC7421 zone)

EMBL: AP009493.PE615

AP009493.PE615       Location/Qualifiers
FT   CDS_pept        720836..721399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_615"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17444"
FT                   /db_xref="GOA:B1VRM6"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM6"
FT                   /protein_id="BAG17444.1"
FT                   /translation="MAISTGAPPRTLRGGLDSLNSRHHQLGLRLFLFIVIAHWAEHLVQ
FT                   AYQIYVMGWPIPEARGVLGMPFPWLVTSEWMHYGYALVMMAGLFLLRSGFTGRSRTWWN
FT                   VSLGIQVWHHLEHLLLLLQVLAGANLLGKAAPTSLIQLLIPRVELHLFYNTLVTVPMVV
FT                   AMYLHTRANRPDNAAARCACAPKD"
     atggccatca gcacgggagc gccaccgcgc acgctgcggg gcggtctcga ctccctcaac        60
     agccgccacc accaactcgg gctgcgcctc ttcctgttca tcgtcatcgc gcactgggcg       120
     gagcacctgg tccaggcgta ccagatctac gtcatgggct ggcccatccc cgaggcgcgc       180
     ggtgtgctcg ggatgccgtt cccgtggctc gtcacatcgg aatggatgca ctacggctac       240
     gccctggtga tgatggccgg cctgttcctg ctgcgctcgg gattcaccgg ccgctcccgg       300
     acctggtgga acgtgtcact cggcatccag gtgtggcatc acctggagca cctgctgctt       360
     ctgctccagg tgctcgcggg cgccaacctg ctgggcaagg ccgctccgac gagcctgatc       420
     cagctgctca tcccccgggt ggagctgcac ctcttctaca acacgctggt caccgtcccc       480
     atggtggtgg cgatgtacct gcacacccgt gcgaaccggc cggacaacgc cgccgcacgg       540
     tgcgcctgcg cgccgaagga ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page