(data stored in ACNUC7421 zone)

EMBL: AP009493.PE616

AP009493.PE616       Location/Qualifiers
FT   CDS_pept        721404..721880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_616"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17445"
FT                   /db_xref="GOA:B1VRM7"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM7"
FT                   /protein_id="BAG17445.1"
FT                   /translation="MATRGRRPSGFVSLLLLLAGVLLFWLTVPNLGNAARAATADGPRG
FT                   TFTAARLVCVGHSGHTTCEWSGTFRSDDGAVETGGVKLYGSGRGTFEAGQTAPAVDVGN
FT                   AGRVYDPSGSRAWIVTVLLVVLAYVLLVTAARRHLAPPPAPSGGRSPATAPPRR"
     gtggccacga gagggagaag accctccggt ttcgtttcgc tgctcctcct cctggccgga        60
     gtcctgctgt tctggctgac ggtgccgaat ctcggcaacg ccgccagggc ggccacggcg       120
     gacgggccgc ggggcacctt caccgcggcc cgtctggtgt gtgtggggca ctccgggcac       180
     accacctgcg aatggtcggg aacgttccgg tcggacgacg gcgccgtgga gaccggtggc       240
     gtcaagctgt acggcagcgg ccggggcacc ttcgaggccg ggcagacggc gccggccgtg       300
     gacgtgggca acgcggggcg ggtctacgac ccgagcggat cgcgtgcgtg gatcgtcacg       360
     gtcctcctgg tggtgctcgc ctacgtcctg ctcgtgaccg cggcccgccg gcatctggcg       420
     cctcctccgg ccccctcggg gggacggagt ccggcaacgg ccccgccccg gcgctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page