(data stored in ACNUC7421 zone)

EMBL: AP009493.PE617

AP009493.PE617       Location/Qualifiers
FT   CDS_pept        complement(721936..723279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_617"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17446"
FT                   /db_xref="GOA:B1VRM8"
FT                   /db_xref="InterPro:IPR010610"
FT                   /db_xref="InterPro:IPR030953"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM8"
FT                   /protein_id="BAG17446.1"
FT                   /translation="MRILFVAAPFRSHLYVQTPLAWALRTAGHDVRIAASPDLADDIAH
FT                   SGLTGVTIGPLVSLSAHMAASAPAPDDAPAAPAPPESATAAGPVPPRAKSHQSQYPLGD
FT                   PVAEMASNVRGWRGMFNPDEAFHDLVRFARLWRPDLIVSDTFTFTGSLAARVTGAAHAR
FT                   ILFGADGLGQLRKACHEFWAHWRDDPAAPPTPADPLREWLEPILRGYGQEFDEDAVLGQ
FT                   WTLFPMPPWIHRPAGVSYIPLRHVPFNGPSTTPPWAYEPPTRRRVCITLGLAHREGGFG
FT                   HSASTRDLLDAVADLDIEVVATFTRDQLEPGQRIPDNVRVADFVPLNVLLPTCSALVHS
FT                   GGAGAFAAALEHGVPQLIVPTMYWSEKWWGPVAMANGLEERGAGVYVADADQLTAKELR
FT                   DHLVRVLDEAEFTENAARLRTEMIAMPSPNDIVPVLEKLTAEHWGTPR"
     gtgcgcattc tcttcgtcgc cgcgcccttc aggtcgcatc tgtacgtgca gacaccgctg        60
     gcgtgggcac tgcggacggc aggacacgat gtgcgcatcg cggcatcccc ggatctggcg       120
     gacgacatcg cccactccgg tctcaccggg gtgacgatcg gcccgctggt cagcctgagc       180
     gcgcacatgg cggcctccgc ccccgccccg gacgacgccc cggccgcccc cgctccaccg       240
     gagtccgcca cggcagccgg tcctgtgccg ccgcgcgcga agtcgcacca gagccagtac       300
     cccctgggcg acccggtcgc cgagatggcg tcgaacgtcc ggggatggcg cggcatgttc       360
     aatcctgacg aggccttcca cgacctcgta cgcttcgccc ggctgtggcg gcccgacctg       420
     atcgtctcgg acacgttcac cttcaccggt tctctcgccg cccgcgtcac cggcgctgcc       480
     cacgcccgca tcctgttcgg cgccgacggc ctcgggcagc tgcggaaggc gtgccacgag       540
     ttctgggccc actggcgtga cgaccccgcc gcacctccca ctcccgccga tcccctgcgg       600
     gagtggctgg agccgatcct gcgcggctac gggcaggagt tcgacgagga cgccgtgctc       660
     ggccagtgga ccctcttccc catgccgccg tggatccacc ggccggccgg cgtgtcctac       720
     atccccctgc gccacgtgcc gttcaacggc ccttccacca ccccgccctg ggcctacgaa       780
     cctcccaccc ggcggcgcgt ctgcatcacc ctcggcctcg cccaccggga gggcggcttc       840
     ggtcactcgg cgtccacccg tgacctgctc gacgcggtgg ccgatctcga catcgaggtg       900
     gtggcgacct tcacccggga ccagctggag ccgggacaac ggatcccgga caacgtccgg       960
     gtggccgact tcgtcccgct caacgtgctt ctgccgacct gctcggccct ggtccacagt      1020
     ggtggcgccg gggctttcgc ggccgccctt gagcacggcg taccccagct catcgtgccc      1080
     accatgtact ggagcgagaa gtggtggggc ccggtcgcca tggccaacgg cctggaggag      1140
     cggggcgccg gcgtctatgt cgccgatgcc gaccagctca ccgccaagga gctgcgtgac      1200
     cacctcgtac gcgtgctcga cgaagcggag ttcaccgaga acgcggcccg gctgcggaca      1260
     gagatgatcg ccatgccgag ccccaacgac atcgtcccgg tgctggagaa actcaccgcg      1320
     gagcactggg gcacaccccg ctga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page