(data stored in ACNUC7421 zone)

EMBL: AP009493.PE618

AP009493.PE618       Location/Qualifiers
FT   CDS_pept        complement(723442..724134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_618"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17447"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM9"
FT                   /protein_id="BAG17447.1"
FT                   /translation="MTEAEKQQSLPRIVSPQEWLAARREFLVREKEFTRARDALNAQRR
FT                   ELPMVAVEKDYVFEGPDGDVGLLDLFEGRRQLIVHHVMFDPSWDEGCSSCRFQIRDLGH
FT                   LPHLHERGTSLALVSRAPYAKIQRYKERMGWSVPYFSSYGSHFNYDFHATLDESKQPLL
FT                   INFRTKEEHEEAVGPWDVWGHELPAVSVFLSEGDTIYHTYSSFSRGLDILLFTLNYLDL
FT                   TPLGRDGG"
     atgaccgaag cagagaagca gcagtccctt ccccgaatcg tctcgccgca ggagtggctc        60
     gccgcgcgcc gcgagttcct cgtcagggag aaggagttca cccgcgcccg ggacgccctc       120
     aacgcccagc gccgcgaact ccccatggtg gcggtggaga aggactacgt cttcgagggc       180
     ccggacggcg acgtggggct cctcgacctg ttcgagggcc ggcgccagct catcgtccac       240
     cacgtgatgt tcgatccgtc ctgggacgag ggctgttcga gctgccgttt ccagatccgc       300
     gacctgggcc atctgccgca cctgcacgag cgcggtacca gcctggcgct ggtctcgcgc       360
     gcaccgtacg ccaagatcca gcgctacaag gagcggatgg ggtggagcgt tccctacttc       420
     tcctcgtacg gaagccactt caactacgac ttccacgcga ccctcgacga gtcgaagcag       480
     ccgttgctga tcaacttccg gaccaaggag gagcacgagg aagcggtcgg accgtgggac       540
     gtgtggggcc acgaactgcc cgcggtcagc gtcttcctga gtgagggcga caccatttac       600
     cacacctact cgtccttctc ccgcgggctg gacatcctgc tcttcaccct caactacctc       660
     gacctcacgc ccctgggcag ggacggcggc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page