(data stored in ACNUC7421 zone)

EMBL: AP009493.PE62

AP009493.PE62        Location/Qualifiers
FT   CDS_pept        complement(66429..66632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_62t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_62t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16891"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ0"
FT                   /protein_id="BAG16891.1"
FT                   /translation="MRRPQIPDERVAWTTVAGEVRQAGVVTFHRLDDTHTKVMLQLDHA
FT                   PQGIADTVGASSASSAGRPRAT"
     ttgcgccggc cccagatccc cgacgaacgg gtggcctgga ccacggtggc gggcgaggtc        60
     cgtcaggcag gtgtggtcac cttccaccgc ctggacgaca cgcacaccaa ggtcatgctc       120
     cagctcgacc acgcccctca gggaatcgcc gacacggtgg gggcaagctc ggcttcgtcc       180
     gccggcaggc caagagcgac ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page