(data stored in ACNUC7421 zone)

EMBL: AP009493.PE620

AP009493.PE620       Location/Qualifiers
FT   CDS_pept        726123..726464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17449"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRN1"
FT                   /protein_id="BAG17449.1"
FT                   /translation="MKYMLLIYSNPAVWEALSDEERAALGPEHAALIEELVESGEWVGG
FT                   SVLAAPSQSRTVRVRDGAALTTDGPFAEVKEHMAGYDIVDCVSVERALEIAARIPDARL
FT                   SGVEVRPLG"
     atgaagtaca tgctcctgat ctacagcaac cccgcggtgt gggaggcgtt gtccgacgag        60
     gagcgtgcgg cgctcgggcc cgagcacgcg gctctgatcg aggagctcgt cgagtccggt       120
     gagtgggtcg gcggttcggt gctggccgcg ccctcgcaga gcaggaccgt tcgggtgcgc       180
     gacggtgcgg cgctcaccac cgacggcccc ttcgccgagg tcaaggagca catggccggc       240
     tacgacatcg tcgactgcgt gagcgtggaa cgggcgctgg agatcgcggc ccgtatcccc       300
     gacgcccggc tgtccggcgt cgaagtccgt ccgctcggct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page