(data stored in ACNUC7421 zone)

EMBL: AP009493.PE623

AP009493.PE623       Location/Qualifiers
FT   CDS_pept        complement(728872..729594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_623"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17452"
FT                   /db_xref="GOA:B1VRN4"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRN4"
FT                   /protein_id="BAG17452.1"
FT                   /translation="MAQQTEPADITLPSPDRKDGPAPEQDPSRPGRAWWRRPWPLLLAL
FT                   LVTLFLVDELTAYLGLDPSEARITLNEDVPLHYPLLVAHIGFGTIALVTVVLQVWPLLR
FT                   RNHPRIHRASGRLYVFAGALPSAVLALAIMPLMPAWQGTIGVAVHALLWIGTTTMGYRA
FT                   ARKRQYDDHRRWMLYSFALATGVLWGRAMVNVMTYAELNIDVGYLFEVARWLGWMINLM
FT                   LVQWWLDRRPNRPAPAPV"
     atggctcagc agaccgaacc ggccgacatc accctgccct ccccggaccg gaaggacggg        60
     cccgcgcccg agcaggaccc gtcgcgcccg ggcagggcct ggtggcgccg cccctggccc       120
     cttctgctgg ccctgctcgt cacgctgttc ctcgtcgacg aactgacggc ctacctgggg       180
     ctggacccgt cggaggcacg gatcacgctg aacgaggacg tgccgctgca ctacccgctg       240
     ctcgtcgcgc acatcggctt cggcaccatc gccctggtca ccgtggttct ccaggtctgg       300
     ccgctgctgc gccgcaacca tccgcggatc caccgggcca gcggccgcct ctacgtgttc       360
     gccggagcgc tgcccagtgc cgtactggct ctggcgatca tgccgctgat gcccgcgtgg       420
     cagggcacca tcggcgtcgc ggtccacgcg ctcctgtgga tcggcaccac caccatgggg       480
     taccgcgcgg cgcgcaagcg gcagtacgac gaccaccggc gctggatgct gtacagcttc       540
     gccctcgcga cgggcgtgct gtggggacgg gccatggtca acgtcatgac gtacgccgag       600
     ctgaacatcg acgtgggata cctcttcgag gtggctcgct ggctcggctg gatgatcaac       660
     ctcatgctcg tccagtggtg gctggaccgc aggccgaacc ggcccgcacc cgcgcccgtc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page