(data stored in ACNUC7421 zone)

EMBL: AP009493.PE624

AP009493.PE624       Location/Qualifiers
FT   CDS_pept        729842..731227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_624"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17453"
FT                   /db_xref="GOA:B1VRN5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRN5"
FT                   /protein_id="BAG17453.1"
FT                   /translation="MSERIGDRAVVLGGSIAGLLAARALARHYTEVVVVDRDRLTGVRG
FT                   PRRGVPHGRHAHGLVARGHQILESLFPGLTEELVEAGIRPGDFSGDIRWYFNGRLLRPA
FT                   RTGLVSVPATRPVLEYHLRLRVQALTGITFLEEHDVLGLVTSSDRRRVTGVRVRPTAED
FT                   AEQRELAADLVVDTTGRGSRTPAWLDEFGYRRPEEEQVKIDLAYTTRHYRLSSDPFGSD
FT                   LAIIPAATPSHPRGAFFYRTPGEGHQVELSLTGVLGDHPPTDPEEFDRFTRSLPVPDIH
FT                   EAVRNAEALDAPVMHRFPASRRRHYERLDRFPERLLVMGDAVCSFNPVYAQGMTVAALQ
FT                   SLVLERHLRAGHAPEPLPFLRDISREIDSPWEFSAGADLGYAGVEAPRPARVRLANAYV
FT                   TRVQKAAVHDPALTNALMRVAGLMEPPQSLMRPATVLRVLRHAARRPPAPPGREVPAPE
FT                   KIA"
     atgagtgagc gcatcgggga tcgtgcggta gtgctgggcg ggagcatcgc ggggctgctg        60
     gccgcccggg ctctcgcccg gcactacacc gaggtcgtcg tcgtggaccg cgaccggctc       120
     accggcgtgc gggggccgcg gcgcggagtg ccgcacggca gacacgccca cggtctggtc       180
     gcacggggcc accagatact cgagtccttg ttcccgggcc tcacggagga gctggtcgag       240
     gcggggatca ggccggggga cttcagcggc gacatccgct ggtacttcaa cggccggctg       300
     ctgcggcccg cccgcaccgg gctggtctcg gtgcccgcca cccggcccgt gctggagtac       360
     cacctgcgcc tccgcgtgca ggcgctcacc ggcatcacgt tcctggagga gcacgatgtg       420
     ctggggctgg tcacgagctc cgaccggcgc cgggtcaccg gggtgagggt acgcccgacg       480
     gccgaggacg ccgagcagcg ggagctcgcc gccgacctgg tggtcgacac cacgggccgg       540
     ggttcgcgca cccccgcgtg gctggacgaa ttcggctacc ggcggcccga ggaggaacag       600
     gtcaagatcg acctggccta cacgacccgg cactaccggc tgtcgtcgga ccccttcggg       660
     agcgacctgg cgatcattcc ggcggcgacc ccctcgcatc cgcgcggggc cttcttctac       720
     cgcacaccgg gtgaaggcca tcaggtcgag ctctccctga cgggggtgct cggcgaccac       780
     ccgccgaccg atcccgagga gttcgaccgc ttcacccggt cgctgcccgt cccggacatc       840
     cacgaagcag tacggaacgc ggaagctctc gacgccccgg tcatgcaccg cttcccggcc       900
     agccggaggc ggcactacga gcggctggac cgcttccccg agagactgct ggtcatgggg       960
     gacgcggtgt gcagcttcaa cccggtgtac gcccagggca tgaccgtcgc ggccctgcag      1020
     tccctcgtgc tggaacggca cctgcgggcg ggacacgcgc cggagcccct ccccttcctg      1080
     cgggacatct cccgcgagat cgactccccc tgggagttct cggcgggcgc ggacctcggt      1140
     tacgcggggg tcgaggcgcc gcgcccggcc cgggtccggc tggccaacgc ctacgtcacc      1200
     cgggtccaga aggccgcggt ccacgacccc gccctcacca acgcgctgat gcgggtggcc      1260
     gggctcatgg agccgccgca gtccctgatg cgtccggcca ccgtgctgcg ggtactgcgg      1320
     cacgcggccc gcaggccccc cgcaccgccg ggccgcgagg tcccggcgcc ggagaagatc      1380
     gcctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page