(data stored in ACNUC7421 zone)

EMBL: AP009493.PE627

AP009493.PE627       Location/Qualifiers
FT   CDS_pept        734354..735544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_627"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17456"
FT                   /db_xref="GOA:B1VRN8"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRN8"
FT                   /protein_id="BAG17456.1"
FT                   /translation="MDTTELAQAPNRADLVARATKLVPLLREKAPWAEENRELHEDTVR
FT                   AMAESGLLRTRLPARLGGYESDMRTQVEVLAELARGDGSASWTAGVWSISAWVAGLFPD
FT                   AVQDEVFTSPDDLVSGIISPTAMAVPAEGGIVVNGRWGFNSGAKHSKWNTNAAVLAMPD
FT                   GSHQPIMTLIPLASLEIVDDWHTAGLRGSGSVSTVAQDVFVPDARYIPLGGLIQGHSGH
FT                   GSNADALIHRAPIMPTACATVSATALGLAKGARDVFFERLPGRKITYTEYADQREAPLT
FT                   HLQVAEASVKIDETEFHVYRIADLVDAKNASGEPWTLEERARVRLDTGAACQRAKEAVD
FT                   VLNTASGASSIYTDVPIQRIERDVQTLNLHAIMHPNTNLELYGRILCGLAPNTQYL"
     gtggacacga ccgaactcgc gcaagcgccg aaccgcgcgg acctcgtcgc ccgcgcgacg        60
     aagttggtgc ctctgctccg cgagaaggcc ccctgggccg aagagaaccg cgagttgcac       120
     gaggacaccg tcagggcgat ggccgaatcc ggcctgttgc gcacccggct gcccgcccgg       180
     ctcggcggtt acgagtccga catgaggacg caggtcgagg tgctcgcgga actggccagg       240
     ggcgacggat ccgcctcgtg gaccgccggt gtgtggtcca tcagcgcgtg ggtcgccggg       300
     ctcttccccg acgcggtgca ggacgaggtg ttcacttcac cggacgacct ggtgagcggc       360
     atcatcagtc cgacggcgat ggcggtgccc gcggagggcg gcatcgtcgt caacggcagg       420
     tgggggttca acagcggggc gaagcacagc aagtggaaca ccaacgcggc ggtgctcgcg       480
     atgccggacg gcagtcatca gccgatcatg actctcattc cgctggcctc gctggagatc       540
     gtcgacgact ggcacaccgc cggcctgcgc ggttcgggca gtgtcagcac ggtcgcccag       600
     gacgtcttcg tgccggacgc ccggtacatc ccgctgggcg gtctgatcca ggggcactcc       660
     gggcacggca gcaacgccga cgccctcatc caccgggcgc cgatcatgcc gacggcgtgc       720
     gccacggtca gcgcgaccgc gctgggactg gccaagggcg ccagggacgt cttcttcgag       780
     cggctgcccg gccggaagat cacgtacacc gagtacgccg accagcgaga ggccccgctg       840
     acccacctcc aggtcgccga ggcgtcggtc aagatcgacg agaccgagtt ccacgtgtac       900
     cgcatcgccg acctcgtgga cgccaagaac gcgtccggcg agccgtggac gctggaggaa       960
     cgcgcgcgcg tccggctcga cacgggcgcg gcgtgtcagc gggcgaagga ggccgtcgac      1020
     gtcctgaaca cagcgagtgg cgcgtcgtcg atctacaccg acgtgcccat ccaacgcatc      1080
     gaacgcgatg tccagacact gaacctgcac gccatcatgc acccgaacac caacctggag      1140
     ctctacggcc gcatcctgtg cggcctggct cccaacacgc agtacctcta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page