(data stored in ACNUC7421 zone)

EMBL: AP009493.PE63

AP009493.PE63        Location/Qualifiers
FT   CDS_pept        complement(66749..67972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_63t"
FT                   /product="putative Dyp-type peroxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_63t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16892"
FT                   /db_xref="GOA:B1VLZ1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ1"
FT                   /protein_id="BAG16892.1"
FT                   /translation="MVMTEHEPTRAPYPGRRALVRGAAGLVGAGGLAATVTVSSASSIP
FT                   MSASTDGRVPFHGAHQAGILTRQQPFGGFVAFDVLARDRAELQALFTKLTARCRALTAG
FT                   VTPKNPEVAALRDPQDRLTITVGVGASLFDERYGLQGARPPGLVNMPLFPGDRLEPDRS
FT                   HGDLSVQICAQHPDAVLHVVRDLARETTGLLRTRWRADGFLNPPRPEGAPRSFIGFKDG
FT                   TAHPDTASKREMNRLVWVGHEGPAWARGGSYQVLRIIGIHAEKWDRVPVAKQEQIFGRR
FT                   KATGAPLDGRKESDLPDYGRDQEGRITPLDSHIRRANPRTPESENSILLRRSYNTDRGL
FT                   TPDGTLDVGLIFCCYQRDIARQFATVQKRLEGERFADFSVTTGGGYFLALPGVADGSDS
FT                   YASALLGQ"
     atggtcatga cggaacacga gcctacccga gcaccgtatc ccggccgccg tgccctggta        60
     cgaggcgctg ctggcctcgt gggggccgga ggcctggccg caacggtgac cgtcagctct       120
     gcgtcgagca tcccgatgag cgcctccacc gatggccggg tgccgttcca cggtgcacac       180
     caggcaggga ttctcacccg gcagcagccg ttcggcggct tcgtcgcctt cgacgtgctc       240
     gcgcgcgacc gggcagagtt gcaggccctt ttcacgaaac tcaccgcacg gtgccgcgcc       300
     ctgacagccg gtgttacacc gaagaatccg gaggtagcgg cgctgcgcga cccgcaagat       360
     cggttgacca tcaccgtcgg cgtaggtgcc tcgcttttcg acgagcggta cggactgcaa       420
     ggagcgcggc caccagggct cgtgaacatg ccactgttcc ccggagaccg gttagaaccc       480
     gaccgctctc acggtgatct ttccgtgcag atctgcgccc agcaccccga cgccgtcctc       540
     cacgtcgtac gcgatctggc ccgggagacc actgggctgc tgcgaacgcg gtggcgggct       600
     gacggcttcc tgaacccacc ccgccccgag ggcgctccac ggtcgttcat cggcttcaag       660
     gacggcaccg cacacccgga caccgcgtcg aagcgcgaaa tgaaccgact cgtctgggtc       720
     ggccacgagg gaccggcatg ggcacgcggc ggaagctacc aggtcctgcg tatcatcgga       780
     attcatgcgg agaaatggga ccgggttccg gtggccaagc aagaacagat cttcggccga       840
     cgcaaagcga ccggcgcacc gctcgacgga cgtaaggaaa gcgacctgcc cgactacgga       900
     cgggaccagg agggccgcat tacgccgctg gactcccata tccgccgcgc caatccgcgc       960
     accccggaaa gcgagaactc gatcttgctg cgccgaagct acaacactga ccggggtctt      1020
     acgcccgacg gaacgctcga cgtaggcttg attttctgct gctaccagcg ggatatcgcc      1080
     cggcagttcg caacggtgca aaaacggctg gaaggcgaga ggttcgcgga cttcagcgtc      1140
     accacgggcg gaggctattt tctcgcgctg cctggagtgg ccgacggctc ggactcctac      1200
     gcctccgctc tgctcggcca gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page