(data stored in ACNUC7421 zone)

EMBL: AP009493.PE635

AP009493.PE635       Location/Qualifiers
FT   CDS_pept        744017..744991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_635"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17464"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030807"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRP6"
FT                   /protein_id="BAG17464.1"
FT                   /translation="MDDRYSPSPLWNYNNSVKVTEEGVAKLASFKSDPVNFKLALWDPQ
FT                   VNGVRYLKALIFELASRLTPENRGRLRRIRHRETGSPISVTHDGDSVCMDYLLAVHELE
FT                   FISRYVEPDGARVLEIGAGYGRTCHAILSNHRVEEYWIIDLGRALALSREYLRTVLDTE
FT                   AFSRVRFVSVDTTDDLDRALGTARFDLCLNVDSFAEMPPETVRNYLALIDRRCSALYVN
FT                   NPVGKYLEKELDNHAQGDEVVRMALATGLLRDLLDIHDSRAVAALAPKFLSSYRPGPRW
FT                   ETVGDGRAVPWSYYWQAVYRRPDEPPTAGRTTGRRTGQRGDAA"
     atggatgacc gatacagccc gagcccgctg tggaattaca acaactccgt caaggtcacc        60
     gaggagggcg tggccaagct ggcctcgttc aaatcggatc cggtgaactt caagctcgca       120
     ctgtgggatc cgcaggtcaa cggggtccgc tatctcaagg cgctgatctt cgaactcgcc       180
     tcgcgtctca ccccggagaa ccgcgggcgt ctgcgcagga tccgtcatcg cgagaccggg       240
     tcacccatct ccgtgaccca cgacggtgac agcgtctgca tggactacct gctcgcggtc       300
     cacgagttgg agttcatcag ccggtacgtc gaacccgacg gcgcgcgcgt cctggagatc       360
     ggcgccggct acgggcggac ctgccacgcg atcctctcca accaccgggt cgaggaatac       420
     tggatcatcg atctgggacg tgccctcgcg ctgtcgaggg agtacctgcg caccgtcctg       480
     gacaccgagg ccttctcccg cgtgaggttc gtgtcggtcg acaccacgga cgacctggac       540
     cgggcgctcg gaaccgcccg cttcgacctg tgcctgaacg tcgactcgtt cgccgagatg       600
     ccaccggaga cggtgcgcaa ctacctcgct ctgatcgacc ggcggtgctc cgcgctctac       660
     gtgaacaacc cggtcggcaa atacctggag aaggaactgg acaaccacgc gcagggcgac       720
     gaggtcgtgc ggatggccct ggcgaccggg ctgctgcggg acctcctcga catccacgac       780
     agccgtgcgg tcgcggctct ggcacccaag ttcctctcgt cctaccggcc gggcccacgc       840
     tgggagaccg tcggcgacgg cagggccgtc ccgtggagtt actactggca ggccgtctac       900
     cggcgaccgg acgaaccccc gacggccggc cgcacgacgg ggcgccgaac cggtcagcgg       960
     ggcgacgcgg cgtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page