(data stored in ACNUC7421 zone)

EMBL: AP009493.PE643

AP009493.PE643       Location/Qualifiers
FT   CDS_pept        751779..752369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_643"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17472"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ4"
FT                   /protein_id="BAG17472.1"
FT                   /translation="MHPDLIVIYTNRLNACQAFYTELGLTFVTEQHGPGPEHYATQLDG
FT                   TVFELYPASPRRPATGSLRLGLTIPVGPRTAPVGQHTHSDPDGRTVVLTVTQQTHPMTT
FT                   AQEARAAIHHAFGDTARTDIKTLPAGNLAITINKGNHAATIDGHDSSGWGWTVDPAEDD
FT                   GFTGHENIAATLDEALTSIRAALIRPGRADGAP"
     atgcaccccg acctcatcgt gatctacacg aaccgcctca acgcctgcca ggccttctac        60
     accgaactcg gcctcacctt cgtcacggaa cagcacggcc cgggacccga gcactacgcc       120
     acccagctcg acggaaccgt cttcgagctc tacccggcca gcccgcgccg cccggcgacc       180
     gggtccctgc gcctcggcct cacgatcccc gtcggccccc gcacggcccc cgtcggccag       240
     cacacccact ccgacccgga cggccgcacc gtcgtcctca ctgtcaccca gcagacacac       300
     cccatgacca ccgcccagga ggcacgggca gcgattcacc acgccttcgg cgacaccgcc       360
     cgtaccgaca tcaagacgct gcccgccgga aacctcgcca tcaccatcaa caagggcaac       420
     cacgctgcca ccatcgacgg ccacgactcc agcggctggg gctggaccgt cgaccccgcc       480
     gaggacgacg gcttcaccgg ccacgagaac atcgccgcca ccctcgacga ggcgctcacc       540
     agcatccgcg ctgccctgat ccgaccaggc cgggccgacg gggccccatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page