(data stored in ACNUC7421 zone)

EMBL: AP009493.PE644

AP009493.PE644       Location/Qualifiers
FT   CDS_pept        752538..752891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_644"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17473"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ5"
FT                   /protein_id="BAG17473.1"
FT                   /translation="MGRRPHPVPMDPASWTALQHCLAHRQGQHTDTPHVIVTKITRTGR
FT                   APASTAHVSHLLDPCGVPPRTLRSTRLADLVNTLDPKLVAAALGMDPEGVMIYLADHVD
FT                   AGRLPIGTKFGAG"
     atgggcagac gcccgcaccc ggtgcccatg gatccggcca gctggacggc actccaacac        60
     tgcctggccc accgtcaggg ccagcacacc gacacccccc acgtgatcgt caccaagatc       120
     accaggaccg gccgggcacc ggcctcaacc gcccatgtca gccacctcct ggacccctgc       180
     ggtgtcccac cgcggaccct gcggagtact cgactcgccg acctggtcaa caccctcgat       240
     cccaagctcg tcgctgcggc cctcggcatg gatcccgaag gcgtcatgat ctacctcgcc       300
     gatcacgtcg acgccggccg gctcccgatt ggcacaaaat tcggtgccgg atag             354
//

If you have problems or comments...

PBIL Back to PBIL home page