(data stored in ACNUC7421 zone)

EMBL: AP009493.PE645

AP009493.PE645       Location/Qualifiers
FT   CDS_pept        752958..753398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_645"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17474"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ6"
FT                   /protein_id="BAG17474.1"
FT                   /translation="MADQTNTQRLYSWGRSRFEKQPTPVAWAGSVLRAANRNLGDFSEV
FT                   DNALLLAETEERWPQAREVFDRLRRRSLDQNAPLNEEQALLFTLAELVAKVAHNAAGMR
FT                   PPFDHDSGWRIWPVAHRLISITDNPELQSELTTALGEGPEDS"
     atggctgatc agacgaacac ccagcgactg tattcatggg gacgttcccg gttcgaaaag        60
     caacccaccc ccgtggcctg ggctggcagc gtacttcgag ccgcgaaccg aaacctcggg       120
     gacttctcag aagtcgacaa tgctctgctg ctggccgaga ccgaggagcg gtggccgcag       180
     gcccgcgaag tcttcgaccg actgcggcga cggagcctgg atcaaaacgc cccgctgaac       240
     gaggagcagg ccctgctgtt caccctcgcg gagctggttg ccaaggtggc gcacaacgcc       300
     gccggcatgc gtcccccatt cgaccatgac tcgggatggc gcatctggcc cgtcgcccac       360
     cggctcatct caatcacaga caaccctgaa cttcagtccg agctcacaac agctctcggc       420
     gaagggccag aggacagctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page