(data stored in ACNUC7421 zone)

EMBL: AP009493.PE646

AP009493.PE646       Location/Qualifiers
FT   CDS_pept        complement(753350..753676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_646"
FT                   /product="putative IS element ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_646"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17475"
FT                   /db_xref="GOA:B1VRQ7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ7"
FT                   /protein_id="BAG17475.1"
FT                   /translation="MVRHLKAAEDQGRLMSKLTSYLRLSVLVVDEECCQPLERTEANLV
FT                   FQVVSKRYEKGSIILTSNKTFGKAHMFRRTCARRRRNSTGSLSLTRRHQLSSGPSPRAV
FT                   VSSD"
     atggtccgcc acctcaaggc cgccgaggac cagggccggc tgatgagcaa gctcaccagc        60
     tatctccggc tcagcgttct cgtggtcgac gaggagtgct gccagcccct ggaacggacc       120
     gaggccaacc tcgtcttcca ggtggtctcc aagcgctacg agaagggctc gatcatcctg       180
     acctcgaaca agaccttcgg caaagcgcac atgttccggc gaacgtgtgc taggcggcgt       240
     cgaaattcaa caggttctct ctcgttaacg cgtcggcatc agctgtcctc tggcccttcg       300
     ccgagagctg ttgtgagctc ggactga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page