(data stored in ACNUC7421 zone)

EMBL: AP009493.PE647

AP009493.PE647       Location/Qualifiers
FT   CDS_pept        753989..754306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_647"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17476"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ8"
FT                   /protein_id="BAG17476.1"
FT                   /translation="MTTPIGPLVLFDDDYHMYVLPDRASAEAWWEMPDEYALGFDALAR
FT                   PLRMAGEPHQVTLELSGDHSAEAELHRLVADHYQRFLPGQAPPQGSDLSEFVAGLPVEG
FT                   A"
     gtgactacac cgataggccc cctggtcctc ttcgatgacg actaccacat gtacgtgctt        60
     ccggaccgag cgtccgcaga ggcatggtgg gagatgcccg acgagtacgc tttggggttc       120
     gacgccttgg ccagaccgtt gcgtatggcg ggtgagccgc atcaggtcac ccttgagctc       180
     agcggtgatc actcggccga ggcagagttg catcgtctcg tagccgacca ctaccagcgc       240
     ttcctgcctg ggcaggcgcc gccccaagga tccgatcttt cggagttcgt tgcgggactg       300
     cctgtcgagg gtgcgtaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page