(data stored in ACNUC7421 zone)

EMBL: AP009493.PE648

AP009493.PE648       Location/Qualifiers
FT   CDS_pept        complement(754341..755021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_648"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17477"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ9"
FT                   /protein_id="BAG17477.1"
FT                   /translation="MRTRRTAVAAVSVAAAAALSAPALASADGRDGHDMNHRGHKALTA
FT                   VGLTADQRLVEFTVDRPARTTDNGRVSGLRGDTKVVGIDFRVQDEKLYGVGDRGGVYTL
FT                   NTANARATKVSQLTVALAGKFGVDFNPAANRLRVISNTGQNLRHNIDDSAAPLGTTTDG
FT                   TLTNPITPPTTATGVTGAAYTNNDLNAATATTLFDIDTMADRVSLQSPANAGTLAPTGN
FT                   RLTS"
     atgcgtacgc gtagaaccgc cgtagccgcc gtctcggtcg ccgcagccgc cgccctgtcc        60
     gctccggccc tggcatccgc ggacggccgc gacggacacg acatgaacca ccgagggcac       120
     aaggcgctca ccgccgtcgg gctgaccgcg gaccagcgcc tggtcgagtt caccgtcgac       180
     cggcccgcca ggaccacgga caacggaagg gtgtccggcc tgcgcggtga caccaaggtc       240
     gtcggcatcg acttccgcgt ccaggacgag aagctctacg gcgtcggcga caggggaggc       300
     gtctacaccc tcaacacggc caacgccagg gccacgaagg tctcccagct cacggtcgcc       360
     ctcgcaggca agttcggcgt cgacttcaac ccggcggcca accggctccg cgtgatcagc       420
     aacacggggc agaacctgcg gcacaacatc gacgacagcg ccgcccctct gggcaccacg       480
     accgacggca cgctcaccaa cccgatcacg ccgcccacca ccgcgacagg cgtcaccggc       540
     gccgcttaca ccaacaacga cctcaacgcc gccaccgcga cgaccctgtt cgacatcgac       600
     accatggccg accgggtctc cctgcaatcg cccgccaacg ccggcaccct tgccccgacc       660
     ggaaacagac tcacttcctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page