(data stored in ACNUC7421 zone)

EMBL: AP009493.PE649

AP009493.PE649       Location/Qualifiers
FT   CDS_pept        755775..757376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_649"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17478"
FT                   /db_xref="InterPro:IPR025566"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR0"
FT                   /protein_id="BAG17478.1"
FT                   /translation="MKDSQSKPRSRRVLDRSLLVLGTTTLAAGLGAMTLAPGLSAASSH
FT                   REAPLIAGDPRADNTDVYAFTSPDKADTVTMVANWIPMEEPNGGPNFYAFGDDLRYNIK
FT                   IDNTGDGVADVTYSWRFRSSYRDDANQFLYNTGQVTSLNDPDLNFRQVYDLVVTTGGKS
FT                   RTVLRGVPAAPSRTGQASMPDYAALRKQATFGLPGGGKTYAGQAEDPFFADLRVFDLLY
FT                   GGDLSERGQDTLAGYNVNTIAIQVPKKQLALRGDSSRNPVIGVWSTTERAGVTVNDSRD
FT                   AKVNKQWKQVSRLGNPLVNEVVVPLKFKDAFNTLNPSQDRTVQPVVDKVYDPILPKLIQ
FT                   QVYGVPAPKTPRNDLAEIYLTGICKVCGPIKADLNAHRLNKDAVLRKIVPAEELRLNMA
FT                   VPPTAKPQRLGVLAGDLAGFPNGRRLADDVIDISLQAVEGAAQTGVLVPALADGDKVDT
FT                   NEVPFGTSFPYVALPHTKNVNRGPGATGRSAEQTATENTAASTAVQPTRAAALAGAGAL
FT                   LLGVGGFRLRRRRKES"
     gtgaaggatt ctcagtcaaa gccccgctca cggcgcgtcc tggaccggtc cctgctcgtc        60
     ctcggtacca ccaccctggc cgcgggactc ggagcgatga ccctcgcccc gggcctcagc       120
     gcggcctcca gccaccgcga ggcacccctg atcgccgggg acccgcgagc ggacaacacc       180
     gacgtgtacg cgttcaccag ccccgacaag gccgacaccg tcacgatggt ggcgaactgg       240
     atcccgatgg aggagcccaa cggcggaccg aacttctacg cgttcggcga cgacctgcgc       300
     tacaacatca agatcgacaa caccggtgac ggcgtcgccg acgtcaccta cagctggcgc       360
     ttccgcagca gctaccgcga cgacgcgaac cagttcctct acaacaccgg gcaggtcacc       420
     tcgctgaacg acccggacct caacttccgc caggtctacg acctcgtcgt caccaccgga       480
     ggaaagagcc gcaccgtcct gcggggcgtc ccggccgcgc cgtcccgtac gggccaggcg       540
     tcgatgcccg actacgcggc cctgcggaag caggcgacgt tcggtctgcc gggcggcggc       600
     aagacgtacg cgggccaggc cgaggacccg ttcttcgccg acctgcgtgt cttcgacctc       660
     ctctacggcg gcgacctgag cgagcgcggg caggacaccc tggccggcta caacgtcaac       720
     accatcgcca tccaggtccc gaagaagcag ctcgccctga ggggcgactc ctcccgcaac       780
     ccggttatcg gggtgtggtc gaccaccgag cgtgcgggcg tcaccgtcaa cgactctcgt       840
     gacgcgaagg tcaacaagca gtggaagcag gtgtcccgcc tggggaaccc gctggtcaac       900
     gaggtcgtcg tcccgctgaa gttcaaggac gcgttcaaca ccctcaaccc cagccaggac       960
     cgcaccgttc agccggtcgt cgacaaggtg tacgacccga tcctgcccaa gctcatccag      1020
     caggtctacg gcgtcccggc ccccaagacg ccccgcaacg acctcgccga gatctacctg      1080
     acgggcatct gcaaggtctg tggtccgatc aaggccgacc tgaacgccca ccgcctcaac      1140
     aaggacgcgg tgctcaggaa gatcgtcccg gcggaggagc tgcgcctgaa catggcggtg      1200
     ccgcccaccg ccaagcccca gcggctcggt gtcctcgcgg gcgacctggc cggcttcccg      1260
     aacgggcgcc gcctcgccga cgacgtcatc gacatctcgc ttcaggccgt cgaaggcgcc      1320
     gcccagaccg gcgttctcgt cccggcgctc gcggacggcg acaaggtgga caccaacgag      1380
     gtccccttcg gcacctcgtt cccctacgtc gcactccccc acacgaagaa cgtgaaccgc      1440
     ggccccggcg cgaccggccg cagtgccgag cagaccgcta cggagaacac cgcggcgagc      1500
     accgccgtcc agcccacccg agcggcggcg ctcgccgggg ccggcgcgct cctcctcgga      1560
     gtcggcggct tccgccttcg ccgccgccgc aaggagagct ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page