(data stored in ACNUC7421 zone)

EMBL: AP009493.PE650

AP009493.PE650       Location/Qualifiers
FT   CDS_pept        757475..758824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17479"
FT                   /db_xref="GOA:B1VRR1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR1"
FT                   /protein_id="BAG17479.1"
FT                   /translation="MHPDHNTPTSTPPPAPSRGSRRLWNIVITMALGATMFAAGAVMLT
FT                   PGANTAPRTGHGRTDEAPRGSIEALQARVARLPKDPGGWAALGMAYVQQARSTADPATY
FT                   DRAEKALRTSLSVQGEGNTDAETAMGALAAARHDFPTALRWARKATTSGPYSSSAYGVL
FT                   ADAHTQLGHYDEADEAVQKMTDLRPDAASLARASYAFELKGNTTRARALMQRSLAAAAT
FT                   PADKAFAHSVLAGLDLQDANPREALARTQNALRTAPTDSALLETRARAYLALGDTTKAV
FT                   ADYKAAIAIAPLPHYLLGLGELEQALGHRERAAENYDLLRAQDRIREAAGDPADTDAIL
FT                   FEADHGNPRRAVALAEGTLRNRPFVAVHDAYAWALHRAGRDTEALVQADKSLAQGTRSA
FT                   IFRYHRAAIHHALGDPAAARRDLTEALREPGFHPLHARAARDLLQRIDTP"
     gtgcacccgg accacaacac acccacgtcc actccgccgc ctgccccgtc gcgtggaagc        60
     cgacggctgt ggaacatcgt gatcaccatg gccctgggcg cgacgatgtt cgccgccggc       120
     gcggtcatgc tgacccccgg cgcgaacacc gcgcctcgta ccggccacgg tcggacggac       180
     gaggcgcccc gcgggtcgat cgaagcgctc caggcccggg tggcccggct cccgaaggat       240
     cccggcggct gggccgccct ggggatggcc tacgtccagc aggcgcgcag caccgctgac       300
     ccggccacct acgaccgggc cgagaaggcc ctacggactt ctctctccgt gcagggcgag       360
     ggcaacacgg acgcggagac cgccatgggc gccctggcag cggcccgcca cgacttcccc       420
     accgcgctgc gctgggcccg caaggccacc accagcgggc cctacagctc ctccgcctac       480
     ggagtcctcg ccgacgccca tacccagctc ggccactacg acgaggccga cgaggccgtc       540
     cagaagatga cggatctccg tccggacgcc gcctccctcg ctcgcgcctc ctacgccttc       600
     gagctcaagg gaaacaccac ccgtgcccgc gccctgatgc aacggtcact ggcggcagcg       660
     gccaccccgg ccgacaaggc tttcgcccac agtgttctgg cggggctcga cctccaggac       720
     gcgaaccccc gcgaagccct ggccaggacg cagaacgccc tcagaaccgc cccgacggat       780
     tcggccctcc tggagacccg tgcccgcgcc tacctggccc tgggcgacac caccaaggcc       840
     gtcgccgact acaaggcggc catcgcgatc gcgcccctcc cgcactacct gttgggcctg       900
     ggcgaactgg agcaggccct ggggcaccgc gaacgggcgg cggagaacta cgacctgctg       960
     cgcgctcagg accgtatccg ggaagccgcc ggcgacccgg cggacaccga cgcgatcctc      1020
     ttcgaagccg atcacggcaa cccgcgacgc gctgtggccc tggccgaagg gaccctccgc      1080
     aaccgcccct tcgtcgccgt ccacgacgcg tacgcctggg ccctgcaccg agccggccgg      1140
     gataccgagg ccctcgtcca agcggacaag tccctggccc agggcacccg cagcgcgatc      1200
     ttccgctacc accgcgccgc catccaccac gccctcggcg acccggcagc ggcccgccgc      1260
     gatctgaccg aggcgctgcg cgagccgggc ttccaccccc tgcacgcccg cgccgcccgc      1320
     gacctgctcc agcgaatcga cactccatga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page