(data stored in ACNUC7421 zone)

EMBL: AP009493.PE651

AP009493.PE651       Location/Qualifiers
FT   CDS_pept        758821..760491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_651"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17480"
FT                   /db_xref="GOA:B1VRR2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR2"
FT                   /protein_id="BAG17480.1"
FT                   /translation="MNNTLRRTLTTLAAGALVAVANVASAPAATAHPLGNFSVNYHTGL
FT                   VLRTDRIDAHVVVDHAEISALQERSAIDTDHDGKVSDDESRVHAEKTCSDLSGQLHLSV
FT                   GGTQAEWRRSSATLVYENGEAGLRTSRLTCSLTSPADLTERAGIRAETDYDTRRVGWHE
FT                   MTATGQGVRITRTDVPATSTTRELRQYPADPLASPLDQRSATLRSEPGQGHAAVPAVVA
FT                   DLPGAGVIGGVLAKVTGAFDSLVGAREITLPVGLLALFLALVLGASHAAMPGHGKTIMA
FT                   AYLAGRRGTRRDALTVGATVTLTHTAGVLVLGLALPVSTHLAGETVLMWLGAASGLLVT
FT                   GIGLWLLTGAVRGTPQHNHHHHGPGHSHSHSHSHSHSHDDHGHHHDHDHGDDSPHHHGP
FT                   VSPASARDSTPAGGLRATPAVATLTPPDHEHHPANTSTAPRDAQRTSRTGLIGMGIAGG
FT                   LVPSPSALVVLLGAVALGRTAFGVLLVIGYGFGMAATLTLAGLLLVRLRERIESHDRAR
FT                   TFRHNPVLRKLARTGPVITSVLVIAVGLGLMLRAAAGTG"
     atgaacaaca ccctgcgccg aaccctcacc accctggccg cgggcgccct cgtcgccgtc        60
     gcgaacgtgg cgtccgcgcc cgccgccacc gcccaccctt tgggcaactt cagcgtcaac       120
     taccacaccg gactcgtcct tcggaccgac cggatcgacg cccacgtcgt ggtcgaccat       180
     gcggagatct cggccctcca ggaacgctcc gccatcgaca ccgatcacga cggcaaggtc       240
     agcgacgacg aatcgcgcgt ccacgccgag aagacctgct cggacctgag cgggcagctc       300
     cacctgagcg tgggaggtac ccaggcggag tggaggcggt cctcggccac cctggtctac       360
     gagaacgggg aggccggtct caggaccagc cgcctcacct gctcactgac cagcccggcc       420
     gacctcaccg agcgcgccgg tatccgggcc gaaacggact acgacaccag gcgcgtcggc       480
     tggcacgaga tgaccgctac cggccagggc gtcaggatca cccggaccga tgtaccggcg       540
     acctccacca cccgcgagct gcgccagtac ccggcggatc ccctcgcctc cccactcgac       600
     cagcgctcgg cgaccctgcg cagtgagccc ggtcagggcc atgcggccgt cccggcggtg       660
     gtggcggacc tccccggcgc gggtgtgatc ggcggggtgc tcgcaaaggt caccggggcc       720
     ttcgactcgc tcgtcggcgc ccgggagatc accctgcccg tggggctgct ggctctgttc       780
     ctggcgctcg tcctcggagc atcccacgcg gcaatgcccg gccacggcaa gaccatcatg       840
     gccgcctacc tcgcgggccg tcgcggcacc aggcgggacg ccctcaccgt cggggccacc       900
     gtcaccctga cgcacaccgc cggcgtcctg gtcctcggcc tcgccctgcc cgtctccacc       960
     catctggcag gagaaaccgt cctgatgtgg ctcggagccg ccagcgggct cctcgtcacc      1020
     ggcatcggcc tctggctcct cacgggagca gtccggggca cgccgcaaca caaccaccat      1080
     caccacggcc cgggtcacag ccacagccac agccacagcc acagccacag ccacgatgac      1140
     cacggccacc accatgatca cgaccacggg gacgacagcc ctcaccacca cggacccgta      1200
     agcccagctt ccgcacgcga cagcacgccg gccgggggac tccgggccac tcccgcggtc      1260
     gcgacactca ccccgccgga ccacgaacac cacccggcca acacgtcgac ggctcctcgg      1320
     gacgctcaac gtacaagccg taccggcctc atcggcatgg gcatcgccgg cggcctcgtc      1380
     cccagcccct ccgccctcgt cgtgctcctc ggcgccgtcg ccctggggcg tacggccttc      1440
     ggcgtgctcc tcgtcatcgg ctacggattc ggcatggccg ccaccctcac cctcgccgga      1500
     ctcctcctcg tacgcctgcg cgaacgcatc gagagccatg accgggcccg gaccttccgc      1560
     cacaaccccg tgctgaggaa actggcgcgg accggacccg tcatcacctc agtcctcgtc      1620
     atcgccgtgg gcctgggtct gatgctgcgg gcagccgccg gaaccggctg a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page