(data stored in ACNUC7421 zone)

EMBL: AP009493.PE652

AP009493.PE652       Location/Qualifiers
FT   CDS_pept        761077..761724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_652"
FT                   /product="conserved hypothetical protein containing a
FT                   fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_652"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17481"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR3"
FT                   /protein_id="BAG17481.1"
FT                   /translation="MTAFRYRRAALALTAATVLPLALSACGGGGSSDTADKAASSAPAE
FT                   EKSSAPAEGTPADGPFGPACASVPKDGAGSFDGMAQDPVATAASNNPDLSTLVTAVKKA
FT                   GLVDTLNNAQNITVFAPTNDAFAKIPKADLDKVLADKEMLTSILTYHVVGEKLSPMQLE
FT                   SGTYDTLQKSPLTTKGSGENYTVNDTSKVVCGNVPTANATVHIVDTVLMPKS"
     gtgactgcct tccgttaccg ccgcgccgcc ctcgccctca ccgcggcgac cgtcctcccc        60
     ctcgccctga gcgcctgcgg gggcggcggt tcgtccgaca ccgccgacaa ggccgcgagc       120
     tccgcccccg cggaggagaa gtccagcgca ccggccgaag gcacccctgc ggacggtccg       180
     ttcggaccgg cctgcgcctc cgtcccgaag gacggtgcgg gctccttcga cggcatggcc       240
     caggacccgg tcgccaccgc ggcctccaac aacccggacc tgtccaccct ggtcaccgcg       300
     gtgaagaagg ccggcctcgt cgacaccctc aacaacgccc agaacatcac ggtgttcgcg       360
     ccgaccaacg acgccttcgc caagatcccc aaggccgacc tcgacaaggt cctggccgac       420
     aaggagatgc tcaccagcat cctcacctac cacgtcgtcg gcgagaagct ctcccccatg       480
     cagctggaga gcggcaccta cgacaccctc cagaagtccc ccctcaccac caagggctcc       540
     ggcgagaact acaccgtcaa cgacacctcg aaggtcgtct gcggcaacgt ccccaccgcc       600
     aacgccaccg tccacatcgt cgacaccgtc ctcatgccca agagctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page